BLASTX nr result
ID: Chrysanthemum21_contig00033479
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00033479 (350 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022039322.1| uncharacterized protein LOC110941936 [Helian... 69 2e-11 ref|XP_021982277.1| uncharacterized protein LOC110878306 [Helian... 67 3e-11 gb|OTG26353.1| hypothetical protein HannXRQ_Chr05g0157701 [Helia... 61 5e-09 ref|XP_022041408.1| uncharacterized protein LOC110943988 [Helian... 57 1e-07 dbj|GAV87289.1| LOW QUALITY PROTEIN: hypothetical protein CFOL_v... 50 5e-07 gb|KVH99011.1| Histidine kinase-like ATPase, ATP-binding domain-... 55 8e-07 ref|XP_023758052.1| uncharacterized protein LOC111906533 [Lactuc... 55 1e-06 >ref|XP_022039322.1| uncharacterized protein LOC110941936 [Helianthus annuus] gb|OTG26350.1| putative DNA binding,ATP binding protein [Helianthus annuus] Length = 1708 Score = 68.6 bits (166), Expect(2) = 2e-11 Identities = 35/59 (59%), Positives = 41/59 (69%) Frame = -3 Query: 333 TYATFYSLL*SVKIFNGREVEIPAQFLDKMSQKK*LKTKCGYKSLNECLLFYSEWERFL 157 T A+ Y+LL SVK +EIP +FLDK+SQK LKT GYK NECLLFYS+W FL Sbjct: 1218 TPASIYALLDSVKRLKEMALEIPDKFLDKLSQKNWLKTHYGYKRPNECLLFYSDWNAFL 1276 Score = 27.7 bits (60), Expect(2) = 2e-11 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -1 Query: 149 GPFIDEEYYGSGIVS 105 GPFIDE++YGS I S Sbjct: 1281 GPFIDEQFYGSPIES 1295 >ref|XP_021982277.1| uncharacterized protein LOC110878306 [Helianthus annuus] Length = 211 Score = 67.4 bits (163), Expect = 3e-11 Identities = 34/59 (57%), Positives = 42/59 (71%) Frame = -3 Query: 333 TYATFYSLL*SVKIFNGREVEIPAQFLDKMSQKK*LKTKCGYKSLNECLLFYSEWERFL 157 T A+ Y+LL S+K R++EIPA+FLDK+ QK LK GYK NECLLFYS W+ FL Sbjct: 70 TPASVYALLDSLKRLKERKLEIPAKFLDKLFQKNWLKPHFGYKRPNECLLFYSAWDSFL 128 >gb|OTG26353.1| hypothetical protein HannXRQ_Chr05g0157701 [Helianthus annuus] Length = 1170 Score = 61.2 bits (147), Expect(2) = 5e-09 Identities = 32/53 (60%), Positives = 37/53 (69%) Frame = -3 Query: 315 SLL*SVKIFNGREVEIPAQFLDKMSQKK*LKTKCGYKSLNECLLFYSEWERFL 157 +LL SVK EIPA+FLDK+SQK LKT GYK NECLLF S+W+ FL Sbjct: 690 ALLDSVKRLKESASEIPAKFLDKLSQKNWLKTYFGYKRPNECLLFSSDWDSFL 742 Score = 26.9 bits (58), Expect(2) = 5e-09 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -1 Query: 149 GPFIDEEYYGSGIVS 105 GPFIDE++YGS I S Sbjct: 747 GPFIDEKFYGSHIDS 761 >ref|XP_022041408.1| uncharacterized protein LOC110943988 [Helianthus annuus] gb|OTG26354.1| putative histidine kinase-like ATPase, C-terminal domain-containing protein [Helianthus annuus] Length = 1702 Score = 57.0 bits (136), Expect(2) = 1e-07 Identities = 30/58 (51%), Positives = 37/58 (63%) Frame = -3 Query: 333 TYATFYSLL*SVKIFNGREVEIPAQFLDKMSQKK*LKTKCGYKSLNECLLFYSEWERF 160 T A+ Y+LL SVK EIP +F +K++QK LKT GYK NECLLF S+W F Sbjct: 1215 TPASSYALLDSVKRLKESASEIPTKFSEKLAQKNWLKTHFGYKRPNECLLFCSDWNPF 1272 Score = 26.2 bits (56), Expect(2) = 1e-07 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -1 Query: 185 CSILNGNVS*TTGPFIDEEYYGSGIVS 105 CS N PFIDE++YGS I S Sbjct: 1266 CSDWNPFFKREDAPFIDEQFYGSRIES 1292 >dbj|GAV87289.1| LOW QUALITY PROTEIN: hypothetical protein CFOL_v3_30715, partial [Cephalotus follicularis] Length = 1651 Score = 50.1 bits (118), Expect(2) = 5e-07 Identities = 25/57 (43%), Positives = 37/57 (64%) Frame = -3 Query: 327 ATFYSLL*SVKIFNGREVEIPAQFLDKMSQKK*LKTKCGYKSLNECLLFYSEWERFL 157 A ++LL +K+ + + P FL K+SQK LKT GY++ +ECLLF S+W+ FL Sbjct: 1168 ANVFTLLECIKVLLEKRISFPEAFLKKVSQKW-LKTYAGYRAPDECLLFDSKWDSFL 1223 Score = 31.2 bits (69), Expect(2) = 5e-07 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -1 Query: 155 TTGPFIDEEYYGSGIVS 105 T GPF+DEE+YGS I S Sbjct: 1226 TDGPFLDEEFYGSNITS 1242 >gb|KVH99011.1| Histidine kinase-like ATPase, ATP-binding domain-containing protein [Cynara cardunculus var. scolymus] Length = 3855 Score = 55.1 bits (131), Expect(2) = 8e-07 Identities = 28/59 (47%), Positives = 38/59 (64%) Frame = -3 Query: 333 TYATFYSLL*SVKIFNGREVEIPAQFLDKMSQKK*LKTKCGYKSLNECLLFYSEWERFL 157 T Y+LL SVK + +IP FL+K+SQK L+T GYK NECLLF +W+++L Sbjct: 1752 TSVNVYALLDSVKKLKEIKAKIPDAFLNKVSQKNWLRTHFGYKCPNECLLFKPKWDQYL 1810 Score = 25.4 bits (54), Expect(2) = 8e-07 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -1 Query: 149 GPFIDEEYYGSGIVS 105 GPFIDE +YG I S Sbjct: 1815 GPFIDEAFYGPAISS 1829 >ref|XP_023758052.1| uncharacterized protein LOC111906533 [Lactuca sativa] gb|PLY98861.1| hypothetical protein LSAT_5X10520 [Lactuca sativa] Length = 1715 Score = 55.1 bits (131), Expect(2) = 1e-06 Identities = 30/63 (47%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -3 Query: 333 TYATFYSLL*SVKIFNGRE-VEIPAQFLDKMSQKK*LKTKCGYKSLNECLLFYSEWERFL 157 T A Y+LL SVK ++P++FLDK+SQK LKT GYK +ECLLF S W+ L Sbjct: 1226 TPANVYALLDSVKKLKEESGTDLPSEFLDKVSQKNWLKTYFGYKRPDECLLFDSSWDSLL 1285 Query: 156 NHR 148 + Sbjct: 1286 KRK 1288 Score = 24.6 bits (52), Expect(2) = 1e-06 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 149 GPFIDEEYYGSGIVS 105 GPFIDE +YG+ I S Sbjct: 1290 GPFIDEGFYGTRIGS 1304