BLASTX nr result
ID: Chrysanthemum21_contig00033437
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00033437 (938 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH97938.1| Proteasome, alpha-subunit, N-terminal domain-cont... 58 5e-06 ref|XP_023734413.1| proteasome subunit alpha type-6 [Lactuca sat... 57 7e-06 ref|XP_022033546.1| proteasome subunit alpha type-6 [Helianthus ... 57 7e-06 >gb|KVH97938.1| Proteasome, alpha-subunit, N-terminal domain-containing protein [Cynara cardunculus var. scolymus] Length = 245 Score = 57.8 bits (138), Expect = 5e-06 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -2 Query: 841 SQVLMQDKLLDPTSVTHLFPVTKFVGLLATGTTRSRL 731 +Q + DKLLDPTSVTHLFPVTKF+GLLATGTT L Sbjct: 52 TQKKVPDKLLDPTSVTHLFPVTKFLGLLATGTTGMHL 88 >ref|XP_023734413.1| proteasome subunit alpha type-6 [Lactuca sativa] gb|PLY97258.1| hypothetical protein LSAT_1X37980 [Lactuca sativa] Length = 246 Score = 57.4 bits (137), Expect = 7e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 841 SQVLMQDKLLDPTSVTHLFPVTKFVGLLATGTT 743 +Q + DKLLDPTSVTHLFPVTKF+GLLATGTT Sbjct: 52 TQKKVPDKLLDPTSVTHLFPVTKFLGLLATGTT 84 >ref|XP_022033546.1| proteasome subunit alpha type-6 [Helianthus annuus] gb|OTG26935.1| putative proteasome subunit alpha type-6 [Helianthus annuus] Length = 246 Score = 57.4 bits (137), Expect = 7e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 841 SQVLMQDKLLDPTSVTHLFPVTKFVGLLATGTT 743 +Q + DKLLDPTSVTHLFPVTKF+GLLATGTT Sbjct: 52 TQKKVPDKLLDPTSVTHLFPVTKFLGLLATGTT 84