BLASTX nr result
ID: Chrysanthemum21_contig00033146
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00033146 (520 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017232978.1| PREDICTED: protein transport protein Sec61 s... 57 3e-06 >ref|XP_017232978.1| PREDICTED: protein transport protein Sec61 subunit alpha-like [Daucus carota subsp. sativus] gb|KZN04312.1| hypothetical protein DCAR_005149 [Daucus carota subsp. sativus] Length = 475 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/41 (58%), Positives = 33/41 (80%) Frame = +3 Query: 24 LSLFVSIIFVHLPVCGINSTTAADPFYWVRLILPSNCETVI 146 +SLF+ ++ LP+ GI+STT ADPFYW+R+IL SNC TV+ Sbjct: 39 ISLFIFLVCSQLPLYGIHSTTGADPFYWMRVILASNCGTVM 79