BLASTX nr result
ID: Chrysanthemum21_contig00033088
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00033088 (636 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021972959.1| cytochrome P450 94B3-like [Helianthus annuus... 67 2e-09 ref|XP_023771519.1| cytochrome P450 94B3 [Lactuca sativa] 64 3e-08 gb|KVH98145.1| cytochrome P450 [Cynara cardunculus var. scolymus] 62 9e-08 ref|XP_022011990.1| cytochrome P450 94B3-like [Helianthus annuus... 57 4e-06 >ref|XP_021972959.1| cytochrome P450 94B3-like [Helianthus annuus] gb|OTG20447.1| putative cytochrome P450 [Helianthus annuus] Length = 510 Score = 67.0 bits (162), Expect = 2e-09 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -2 Query: 203 VNEIIRERRQQMDGSESERDLLSRFILAGRDDEMVRGMVISF 78 VNEIIRERR+QMDGSE+ RDLLSRFI AG D++VR MVISF Sbjct: 267 VNEIIRERREQMDGSENHRDLLSRFISAGYSDDLVRDMVISF 308 >ref|XP_023771519.1| cytochrome P450 94B3 [Lactuca sativa] Length = 510 Score = 63.9 bits (154), Expect = 3e-08 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -2 Query: 203 VNEIIRERRQQMDGSESERDLLSRFILAGRDDEMVRGMVISF 78 V EIIRERR+QM GSES RDLLSRFI AG DE+VR MVISF Sbjct: 261 VTEIIRERRKQMAGSESRRDLLSRFISAGHGDELVRDMVISF 302 >gb|KVH98145.1| cytochrome P450 [Cynara cardunculus var. scolymus] Length = 483 Score = 62.4 bits (150), Expect = 9e-08 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = -2 Query: 203 VNEIIRERRQQMDGSESERDLLSRFILAGRDDEMVRGMVISF 78 VN+II +RR+QMDG++S+RDLLSRFI AG DE+VR MVISF Sbjct: 242 VNKIIGDRRRQMDGNDSQRDLLSRFISAGHGDELVRDMVISF 283 >ref|XP_022011990.1| cytochrome P450 94B3-like [Helianthus annuus] gb|OTG33470.1| putative cytochrome P450, family 94, subfamily B, polypeptide 3 [Helianthus annuus] Length = 500 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/42 (61%), Positives = 36/42 (85%) Frame = -2 Query: 203 VNEIIRERRQQMDGSESERDLLSRFILAGRDDEMVRGMVISF 78 V+EIIR RR+ MDGS++++DLLSRFI +G D+++R MVISF Sbjct: 261 VDEIIRARREHMDGSDNKKDLLSRFISSGHSDDLMRDMVISF 302