BLASTX nr result
ID: Chrysanthemum21_contig00032983
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00032983 (393 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022013198.1| cell division control protein 6 homolog B-li... 104 4e-26 ref|XP_022013194.1| cell division control protein 6 homolog B-li... 104 6e-26 ref|XP_022013193.1| cell division control protein 6 homolog B-li... 104 7e-26 ref|XP_022013187.1| cell division control protein 6 homolog B-li... 104 7e-26 ref|XP_021977914.1| cell division control protein 6 homolog B-li... 108 3e-25 gb|OTG19032.1| putative cell division control, Cdc6 [Helianthus ... 108 4e-25 gb|OTF87461.1| putative cell division control 6 [Helianthus annuus] 108 5e-25 ref|XP_022022864.1| cell division control protein 6 homolog B-li... 100 2e-24 ref|XP_022022863.1| cell division control protein 6 homolog B-li... 100 3e-24 gb|OTF86488.1| putative winged helix-turn-helix DNA-binding doma... 100 3e-24 ref|XP_022022859.1| cell division control protein 6 homolog B-li... 100 3e-24 ref|XP_022022857.1| cell division control protein 6 homolog B-li... 100 4e-24 ref|XP_023732240.1| cell division control protein 6 homolog B-li... 102 6e-23 ref|XP_019258377.1| PREDICTED: cell division control protein 6 h... 98 2e-21 gb|OIT40563.1| cell division control protein 6 -like b [Nicotian... 98 3e-21 ref|XP_009787237.1| PREDICTED: cell division control protein 6 h... 98 3e-21 ref|XP_009787236.1| PREDICTED: cell division control protein 6 h... 98 3e-21 ref|XP_016501100.1| PREDICTED: cell division control protein 6 h... 98 3e-21 ref|XP_009787234.1| PREDICTED: cell division control protein 6 h... 98 3e-21 ref|XP_016503231.1| PREDICTED: cell division control protein 6 h... 98 4e-21 >ref|XP_022013198.1| cell division control protein 6 homolog B-like isoform X4 [Helianthus annuus] ref|XP_022013199.1| cell division control protein 6 homolog B-like isoform X4 [Helianthus annuus] ref|XP_022013200.1| cell division control protein 6 homolog B-like isoform X4 [Helianthus annuus] Length = 145 Score = 104 bits (260), Expect = 4e-26 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = -1 Query: 393 VGIMELSCMCRVLGDQGILKLGQSRDDKLRRVTLQVDEADINFALQGIRFFRNFLQ 226 VGIMELSCMCRVLGDQGILKLGQSRD+KLR VTLQVDEADI+FALQGIRFFRN LQ Sbjct: 83 VGIMELSCMCRVLGDQGILKLGQSRDNKLRTVTLQVDEADISFALQGIRFFRNSLQ 138 >ref|XP_022013194.1| cell division control protein 6 homolog B-like isoform X3 [Helianthus annuus] ref|XP_022013195.1| cell division control protein 6 homolog B-like isoform X3 [Helianthus annuus] ref|XP_022013196.1| cell division control protein 6 homolog B-like isoform X3 [Helianthus annuus] ref|XP_022013197.1| cell division control protein 6 homolog B-like isoform X3 [Helianthus annuus] Length = 158 Score = 104 bits (260), Expect = 6e-26 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = -1 Query: 393 VGIMELSCMCRVLGDQGILKLGQSRDDKLRRVTLQVDEADINFALQGIRFFRNFLQ 226 VGIMELSCMCRVLGDQGILKLGQSRD+KLR VTLQVDEADI+FALQGIRFFRN LQ Sbjct: 103 VGIMELSCMCRVLGDQGILKLGQSRDNKLRTVTLQVDEADISFALQGIRFFRNSLQ 158 >ref|XP_022013193.1| cell division control protein 6 homolog B-like isoform X2 [Helianthus annuus] Length = 164 Score = 104 bits (260), Expect = 7e-26 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = -1 Query: 393 VGIMELSCMCRVLGDQGILKLGQSRDDKLRRVTLQVDEADINFALQGIRFFRNFLQ 226 VGIMELSCMCRVLGDQGILKLGQSRD+KLR VTLQVDEADI+FALQGIRFFRN LQ Sbjct: 102 VGIMELSCMCRVLGDQGILKLGQSRDNKLRTVTLQVDEADISFALQGIRFFRNSLQ 157 >ref|XP_022013187.1| cell division control protein 6 homolog B-like isoform X1 [Helianthus annuus] ref|XP_022013188.1| cell division control protein 6 homolog B-like isoform X1 [Helianthus annuus] ref|XP_022013189.1| cell division control protein 6 homolog B-like isoform X1 [Helianthus annuus] ref|XP_022013190.1| cell division control protein 6 homolog B-like isoform X1 [Helianthus annuus] ref|XP_022013191.1| cell division control protein 6 homolog B-like isoform X1 [Helianthus annuus] ref|XP_022013192.1| cell division control protein 6 homolog B-like isoform X1 [Helianthus annuus] Length = 165 Score = 104 bits (260), Expect = 7e-26 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = -1 Query: 393 VGIMELSCMCRVLGDQGILKLGQSRDDKLRRVTLQVDEADINFALQGIRFFRNFLQ 226 VGIMELSCMCRVLGDQGILKLGQSRD+KLR VTLQVDEADI+FALQGIRFFRN LQ Sbjct: 103 VGIMELSCMCRVLGDQGILKLGQSRDNKLRTVTLQVDEADISFALQGIRFFRNSLQ 158 >ref|XP_021977914.1| cell division control protein 6 homolog B-like [Helianthus annuus] Length = 494 Score = 108 bits (271), Expect = 3e-25 Identities = 54/56 (96%), Positives = 55/56 (98%) Frame = -1 Query: 393 VGIMELSCMCRVLGDQGILKLGQSRDDKLRRVTLQVDEADINFALQGIRFFRNFLQ 226 VGIMELSCMCRVLGDQGILKLGQSRDDKLRRVTLQVDEADI+FALQGIRFFRN LQ Sbjct: 439 VGIMELSCMCRVLGDQGILKLGQSRDDKLRRVTLQVDEADISFALQGIRFFRNCLQ 494 >gb|OTG19032.1| putative cell division control, Cdc6 [Helianthus annuus] Length = 527 Score = 108 bits (271), Expect = 4e-25 Identities = 54/56 (96%), Positives = 55/56 (98%) Frame = -1 Query: 393 VGIMELSCMCRVLGDQGILKLGQSRDDKLRRVTLQVDEADINFALQGIRFFRNFLQ 226 VGIMELSCMCRVLGDQGILKLGQSRDDKLRRVTLQVDEADI+FALQGIRFFRN LQ Sbjct: 472 VGIMELSCMCRVLGDQGILKLGQSRDDKLRRVTLQVDEADISFALQGIRFFRNCLQ 527 >gb|OTF87461.1| putative cell division control 6 [Helianthus annuus] Length = 561 Score = 108 bits (271), Expect = 5e-25 Identities = 54/56 (96%), Positives = 55/56 (98%) Frame = -1 Query: 393 VGIMELSCMCRVLGDQGILKLGQSRDDKLRRVTLQVDEADINFALQGIRFFRNFLQ 226 VGIMELSCMCRVLGDQGILKLGQSRDDKLRRVTLQVDEADI+FALQGIRFFRN LQ Sbjct: 506 VGIMELSCMCRVLGDQGILKLGQSRDDKLRRVTLQVDEADISFALQGIRFFRNCLQ 561 >ref|XP_022022864.1| cell division control protein 6 homolog B-like isoform X4 [Helianthus annuus] Length = 161 Score = 100 bits (250), Expect = 2e-24 Identities = 51/56 (91%), Positives = 52/56 (92%) Frame = -1 Query: 393 VGIMELSCMCRVLGDQGILKLGQSRDDKLRRVTLQVDEADINFALQGIRFFRNFLQ 226 VGIMELSCMCRVLGDQGILKL QSRDDKLR TLQVDEADI+FALQGIRFFRN LQ Sbjct: 99 VGIMELSCMCRVLGDQGILKLRQSRDDKLRTRTLQVDEADISFALQGIRFFRNSLQ 154 >ref|XP_022022863.1| cell division control protein 6 homolog B-like isoform X3 [Helianthus annuus] Length = 170 Score = 100 bits (250), Expect = 3e-24 Identities = 51/56 (91%), Positives = 52/56 (92%) Frame = -1 Query: 393 VGIMELSCMCRVLGDQGILKLGQSRDDKLRRVTLQVDEADINFALQGIRFFRNFLQ 226 VGIMELSCMCRVLGDQGILKL QSRDDKLR TLQVDEADI+FALQGIRFFRN LQ Sbjct: 108 VGIMELSCMCRVLGDQGILKLRQSRDDKLRTRTLQVDEADISFALQGIRFFRNSLQ 163 >gb|OTF86488.1| putative winged helix-turn-helix DNA-binding domain-containing protein [Helianthus annuus] Length = 171 Score = 100 bits (250), Expect = 3e-24 Identities = 51/56 (91%), Positives = 52/56 (92%) Frame = -1 Query: 393 VGIMELSCMCRVLGDQGILKLGQSRDDKLRRVTLQVDEADINFALQGIRFFRNFLQ 226 VGIMELSCMCRVLGDQGILKL QSRDDKLR TLQVDEADI+FALQGIRFFRN LQ Sbjct: 116 VGIMELSCMCRVLGDQGILKLRQSRDDKLRTRTLQVDEADISFALQGIRFFRNSLQ 171 >ref|XP_022022859.1| cell division control protein 6 homolog B-like isoform X2 [Helianthus annuus] ref|XP_022022861.1| cell division control protein 6 homolog B-like isoform X2 [Helianthus annuus] ref|XP_022022862.1| cell division control protein 6 homolog B-like isoform X2 [Helianthus annuus] Length = 181 Score = 100 bits (250), Expect = 3e-24 Identities = 51/56 (91%), Positives = 52/56 (92%) Frame = -1 Query: 393 VGIMELSCMCRVLGDQGILKLGQSRDDKLRRVTLQVDEADINFALQGIRFFRNFLQ 226 VGIMELSCMCRVLGDQGILKL QSRDDKLR TLQVDEADI+FALQGIRFFRN LQ Sbjct: 126 VGIMELSCMCRVLGDQGILKLRQSRDDKLRTRTLQVDEADISFALQGIRFFRNSLQ 181 >ref|XP_022022857.1| cell division control protein 6 homolog B-like isoform X1 [Helianthus annuus] ref|XP_022022858.1| cell division control protein 6 homolog B-like isoform X1 [Helianthus annuus] Length = 188 Score = 100 bits (250), Expect = 4e-24 Identities = 51/56 (91%), Positives = 52/56 (92%) Frame = -1 Query: 393 VGIMELSCMCRVLGDQGILKLGQSRDDKLRRVTLQVDEADINFALQGIRFFRNFLQ 226 VGIMELSCMCRVLGDQGILKL QSRDDKLR TLQVDEADI+FALQGIRFFRN LQ Sbjct: 126 VGIMELSCMCRVLGDQGILKLRQSRDDKLRTRTLQVDEADISFALQGIRFFRNSLQ 181 >ref|XP_023732240.1| cell division control protein 6 homolog B-like [Lactuca sativa] gb|PLY75070.1| hypothetical protein LSAT_9X19501 [Lactuca sativa] Length = 502 Score = 102 bits (255), Expect = 6e-23 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -1 Query: 393 VGIMELSCMCRVLGDQGILKLGQSRDDKLRRVTLQVDEADINFALQGIRFFRNFLQ 226 VGIMELSCMCRVLGDQGILKLGQSRDDKL+RVTLQV+EADI FALQGIRFF N LQ Sbjct: 442 VGIMELSCMCRVLGDQGILKLGQSRDDKLKRVTLQVEEADIIFALQGIRFFHNCLQ 497 >ref|XP_019258377.1| PREDICTED: cell division control protein 6 homolog B-like [Nicotiana attenuata] Length = 443 Score = 98.2 bits (243), Expect = 2e-21 Identities = 47/56 (83%), Positives = 52/56 (92%) Frame = -1 Query: 393 VGIMELSCMCRVLGDQGILKLGQSRDDKLRRVTLQVDEADINFALQGIRFFRNFLQ 226 VGIMELS MCRVLGDQGILK+GQ+R+DKLRRVTL +DEADI FALQGIR FRN+LQ Sbjct: 386 VGIMELSSMCRVLGDQGILKVGQAREDKLRRVTLNIDEADITFALQGIRLFRNYLQ 441 >gb|OIT40563.1| cell division control protein 6 -like b [Nicotiana attenuata] Length = 491 Score = 98.2 bits (243), Expect = 3e-21 Identities = 47/56 (83%), Positives = 52/56 (92%) Frame = -1 Query: 393 VGIMELSCMCRVLGDQGILKLGQSRDDKLRRVTLQVDEADINFALQGIRFFRNFLQ 226 VGIMELS MCRVLGDQGILK+GQ+R+DKLRRVTL +DEADI FALQGIR FRN+LQ Sbjct: 434 VGIMELSSMCRVLGDQGILKVGQAREDKLRRVTLNIDEADITFALQGIRLFRNYLQ 489 >ref|XP_009787237.1| PREDICTED: cell division control protein 6 homolog isoform X3 [Nicotiana sylvestris] Length = 531 Score = 98.2 bits (243), Expect = 3e-21 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -1 Query: 393 VGIMELSCMCRVLGDQGILKLGQSRDDKLRRVTLQVDEADINFALQGIRFFRNFLQ 226 VGIMELS MCRVLGDQGILK+GQ+R+DKLRRVTL+VDEADI FALQGIR FRN+LQ Sbjct: 474 VGIMELSNMCRVLGDQGILKVGQAREDKLRRVTLKVDEADITFALQGIRLFRNYLQ 529 >ref|XP_009787236.1| PREDICTED: cell division control protein 6 homolog isoform X2 [Nicotiana sylvestris] Length = 533 Score = 98.2 bits (243), Expect = 3e-21 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -1 Query: 393 VGIMELSCMCRVLGDQGILKLGQSRDDKLRRVTLQVDEADINFALQGIRFFRNFLQ 226 VGIMELS MCRVLGDQGILK+GQ+R+DKLRRVTL+VDEADI FALQGIR FRN+LQ Sbjct: 476 VGIMELSNMCRVLGDQGILKVGQAREDKLRRVTLKVDEADITFALQGIRLFRNYLQ 531 >ref|XP_016501100.1| PREDICTED: cell division control protein 6 homolog B-like [Nicotiana tabacum] Length = 535 Score = 98.2 bits (243), Expect = 3e-21 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -1 Query: 393 VGIMELSCMCRVLGDQGILKLGQSRDDKLRRVTLQVDEADINFALQGIRFFRNFLQ 226 VGIMELS MCRVLGDQGILK+GQ+R+DKLRRVTL+VDEADI FALQGIR FRN+LQ Sbjct: 478 VGIMELSNMCRVLGDQGILKVGQAREDKLRRVTLKVDEADITFALQGIRLFRNYLQ 533 >ref|XP_009787234.1| PREDICTED: cell division control protein 6 homolog isoform X1 [Nicotiana sylvestris] ref|XP_009787235.1| PREDICTED: cell division control protein 6 homolog isoform X1 [Nicotiana sylvestris] Length = 535 Score = 98.2 bits (243), Expect = 3e-21 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -1 Query: 393 VGIMELSCMCRVLGDQGILKLGQSRDDKLRRVTLQVDEADINFALQGIRFFRNFLQ 226 VGIMELS MCRVLGDQGILK+GQ+R+DKLRRVTL+VDEADI FALQGIR FRN+LQ Sbjct: 478 VGIMELSNMCRVLGDQGILKVGQAREDKLRRVTLKVDEADITFALQGIRLFRNYLQ 533 >ref|XP_016503231.1| PREDICTED: cell division control protein 6 homolog B-like isoform X4 [Nicotiana tabacum] Length = 502 Score = 97.8 bits (242), Expect = 4e-21 Identities = 47/56 (83%), Positives = 53/56 (94%) Frame = -1 Query: 393 VGIMELSCMCRVLGDQGILKLGQSRDDKLRRVTLQVDEADINFALQGIRFFRNFLQ 226 VGIMELS MCRVLGDQGILK+GQ+R+DKLRRVTL++DEADI FALQGIR FRN+LQ Sbjct: 445 VGIMELSNMCRVLGDQGILKVGQAREDKLRRVTLKIDEADITFALQGIRLFRNYLQ 500