BLASTX nr result
ID: Chrysanthemum21_contig00032927
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00032927 (507 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023751758.1| glutamic acid-rich protein-like [Lactuca sat... 73 2e-13 ref|XP_022016167.1| nucleolin-like isoform X1 [Helianthus annuus... 63 9e-10 ref|XP_022016169.1| nucleolin-like isoform X2 [Helianthus annuus] 54 4e-06 >ref|XP_023751758.1| glutamic acid-rich protein-like [Lactuca sativa] Length = 116 Score = 72.8 bits (177), Expect = 2e-13 Identities = 36/44 (81%), Positives = 37/44 (84%) Frame = +3 Query: 150 MASAQVDVPHVEEFTKPSEETTLGSPTIEESAKAPAAHNTESPY 281 MA+AQVD VEEFTK SEETTLGSPTIEES KAPA HN ESPY Sbjct: 1 MAAAQVDAAQVEEFTKLSEETTLGSPTIEESEKAPAPHNIESPY 44 >ref|XP_022016167.1| nucleolin-like isoform X1 [Helianthus annuus] gb|OTF91180.1| hypothetical protein HannXRQ_Chr16g0507901 [Helianthus annuus] Length = 117 Score = 63.2 bits (152), Expect = 9e-10 Identities = 32/45 (71%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = +3 Query: 150 MASAQVDVPHVEEFTKPSEETTLGSPT-IEESAKAPAAHNTESPY 281 MASAQVD VEEF KPSEETT+GSPT +EES KAPA + +SPY Sbjct: 1 MASAQVDATQVEEFIKPSEETTVGSPTNVEESTKAPAPEDIKSPY 45 >ref|XP_022016169.1| nucleolin-like isoform X2 [Helianthus annuus] Length = 112 Score = 53.5 bits (127), Expect = 4e-06 Identities = 30/45 (66%), Positives = 34/45 (75%), Gaps = 1/45 (2%) Frame = +3 Query: 150 MASAQVDVPHVEEFTKPSEETTLGSPT-IEESAKAPAAHNTESPY 281 MASAQV EEF KPSEETT+GSPT +EES KAPA + +SPY Sbjct: 1 MASAQV-----EEFIKPSEETTVGSPTNVEESTKAPAPEDIKSPY 40