BLASTX nr result
ID: Chrysanthemum21_contig00032611
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00032611 (466 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022041646.1| putative disease resistance protein At4g1905... 58 1e-06 >ref|XP_022041646.1| putative disease resistance protein At4g19050 [Helianthus annuus] ref|XP_022041648.1| putative disease resistance protein At4g19050 [Helianthus annuus] gb|OTG36087.1| putative NB-ARC [Helianthus annuus] Length = 1553 Score = 57.8 bits (138), Expect = 1e-06 Identities = 30/57 (52%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -2 Query: 465 RSCEKIKTLFTDINNKPA-TSLNTLHLEDLPVLKRIGAXXXXXXXXVESECPNLEPI 298 RSCE++K L TDI++K +L LHLE+LPVLK+IGA ECPN+EPI Sbjct: 1495 RSCERMKNLCTDIDSKTTWENLKKLHLEELPVLKQIGAFVPPTVKPSVVECPNVEPI 1551