BLASTX nr result
ID: Chrysanthemum21_contig00032477
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00032477 (360 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023771433.1| nuclear receptor corepressor 2-like [Lactuca... 57 4e-07 >ref|XP_023771433.1| nuclear receptor corepressor 2-like [Lactuca sativa] ref|XP_023771434.1| nuclear receptor corepressor 2-like [Lactuca sativa] gb|PLY79579.1| hypothetical protein LSAT_2X90140 [Lactuca sativa] Length = 329 Score = 57.4 bits (137), Expect = 4e-07 Identities = 31/54 (57%), Positives = 37/54 (68%), Gaps = 4/54 (7%) Frame = -2 Query: 152 ADVDIVNGSPTKSPPIQVMS----YDSDRILSSKIVKKRRNDSEWSLASNESLF 3 +D D N SP +SPPIQVM+ YD +RI SS K+ +DSEWS ASNESLF Sbjct: 101 SDFDTSNASPIQSPPIQVMAQSDDYDRNRIPSSIFSPKQSDDSEWSAASNESLF 154