BLASTX nr result
ID: Chrysanthemum21_contig00032460
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00032460 (394 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021995312.1| receptor-like serine/threonine-protein kinas... 53 4e-06 >ref|XP_021995312.1| receptor-like serine/threonine-protein kinase SD1-8 [Helianthus annuus] gb|OTG04213.1| putative tyrosine-protein kinase, insulin-like receptor [Helianthus annuus] Length = 122 Score = 52.8 bits (125), Expect = 4e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +1 Query: 1 IGLLCIQANPKDRPTMEEVVGMLIGTSSIDLL 96 IGLLC+Q N DRPTMEEVVGML+G+SS+ LL Sbjct: 84 IGLLCVQENAADRPTMEEVVGMLLGSSSLTLL 115