BLASTX nr result
ID: Chrysanthemum21_contig00032400
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00032400 (602 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH92398.1| Aminotransferase-like, plant mobile domain-contai... 59 2e-06 >gb|KVH92398.1| Aminotransferase-like, plant mobile domain-containing protein, partial [Cynara cardunculus var. scolymus] Length = 1027 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +2 Query: 236 NANGALQLVPTDPDVLDCSICYEPLCTPVFRM*NGY 343 NA GALQ+V TDPDVLDC IC +PLCTPVF+ NG+ Sbjct: 162 NAIGALQVVLTDPDVLDCPICLDPLCTPVFQCENGH 197