BLASTX nr result
ID: Chrysanthemum21_contig00032127
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00032127 (446 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007624854.1| Ycf1 protein (chloroplast) [Artemisia frigid... 99 6e-46 ref|YP_009272134.1| Ycf1 (chloroplast) [Artemisia argyi] >gi|743... 99 6e-46 ref|YP_009111796.1| Ycf1 protein (chloroplast) [Artemisia montan... 99 6e-46 gb|ARU07869.1| Ycf1 (chloroplast) [Artemisia gmelinii] 99 6e-46 ref|YP_009307812.1| Ycf1 (chloroplast) [Artemisia gmelinii] >gi|... 99 6e-46 gb|AVI25957.1| photosystem I assembly protein Ycf1 (chloroplast)... 98 2e-45 ref|YP_009365300.1| Ycf1 protein (plastid) [Artemisia annua] >gi... 97 3e-45 gb|ANS11316.1| Ycf1 (chloroplast) [Artemisia fukudo] 97 3e-45 ref|YP_009307900.1| Ycf1 (chloroplast) [Artemisia capillaris] >g... 95 3e-43 ref|YP_009377192.1| hypothetical chloroplast RF1 (chloroplast) [... 92 6e-37 ref|YP_009375407.1| hypothetical chloroplast RF1 (chloroplast) [... 92 8e-37 ref|YP_009255922.1| hypothetical chloroplast RF1 (chloroplast) [... 92 2e-36 ref|YP_588165.1| hypothetical chloroplast RF1 (chloroplast) [Hel... 92 2e-36 gb|AVN90138.1| hypothetical chloroplast RF19 (chloroplast) [Heli... 92 2e-36 gb|AHB16970.1| hypothetical chloroplast RF19 (plastid) [Helianth... 92 2e-36 gb|AHB16545.1| hypothetical chloroplast RF19 (plastid) [Helianth... 92 2e-36 gb|AHB16205.1| hypothetical chloroplast RF19 (plastid) [Helianth... 92 2e-36 ref|YP_008964659.1| hypothetical chloroplast RF19 [Helianthus tu... 92 2e-36 gb|AHB15440.1| hypothetical chloroplast RF19 (plastid) [Helianth... 92 2e-36 ref|YP_008964489.1| hypothetical chloroplast RF19 [Helianthus de... 92 2e-36 >ref|YP_007624854.1| Ycf1 protein (chloroplast) [Artemisia frigida] gb|AFP98881.1| Ycf1 protein (chloroplast) [Artemisia frigida] Length = 1687 Score = 99.0 bits (245), Expect(3) = 6e-46 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +1 Query: 250 SYKLINELEQMFKKRRKEQSIMQGLDHQLRTRKFKRIAFLTRSNRSFKKS 399 SYKLINELEQMFKKRRKEQ IMQGLDHQLRTRKFKRIAFLTRSNRSFKKS Sbjct: 539 SYKLINELEQMFKKRRKEQGIMQGLDHQLRTRKFKRIAFLTRSNRSFKKS 588 Score = 81.6 bits (200), Expect(3) = 6e-46 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = +3 Query: 3 KENSIENCTEPSEINKIHDILLHYPTFPESEQKIEISEKNK*KL 134 KENSIENCTEPSEINKIHDILL YPTFPESEQKIEISEK + K+ Sbjct: 457 KENSIENCTEPSEINKIHDILLPYPTFPESEQKIEISEKKQVKI 500 Score = 52.4 bits (124), Expect(3) = 6e-46 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +2 Query: 116 KKQVKIDSNNRLKFSLNAILTNPKR 190 KKQVKIDSNNRLKFSLNAILTNPKR Sbjct: 495 KKQVKIDSNNRLKFSLNAILTNPKR 519 >ref|YP_009272134.1| Ycf1 (chloroplast) [Artemisia argyi] gb|AJB98685.1| Ycf1 (chloroplast) [Artemisia argyi] Length = 1678 Score = 99.0 bits (245), Expect(3) = 6e-46 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +1 Query: 250 SYKLINELEQMFKKRRKEQSIMQGLDHQLRTRKFKRIAFLTRSNRSFKKS 399 SYKLINELEQMFKKRRKEQ IMQGLDHQLRTRKFKRIAFLTRSNRSFKKS Sbjct: 539 SYKLINELEQMFKKRRKEQGIMQGLDHQLRTRKFKRIAFLTRSNRSFKKS 588 Score = 81.6 bits (200), Expect(3) = 6e-46 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = +3 Query: 3 KENSIENCTEPSEINKIHDILLHYPTFPESEQKIEISEKNK*KL 134 KENSIENCTEPSEINKIHDILL YPTFPESEQKIEISEK + K+ Sbjct: 457 KENSIENCTEPSEINKIHDILLPYPTFPESEQKIEISEKKQVKI 500 Score = 52.4 bits (124), Expect(3) = 6e-46 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +2 Query: 116 KKQVKIDSNNRLKFSLNAILTNPKR 190 KKQVKIDSNNRLKFSLNAILTNPKR Sbjct: 495 KKQVKIDSNNRLKFSLNAILTNPKR 519 >ref|YP_009111796.1| Ycf1 protein (chloroplast) [Artemisia montana] gb|AHJ61204.1| Ycf1 protein (chloroplast) [Artemisia montana] Length = 1678 Score = 99.0 bits (245), Expect(3) = 6e-46 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +1 Query: 250 SYKLINELEQMFKKRRKEQSIMQGLDHQLRTRKFKRIAFLTRSNRSFKKS 399 SYKLINELEQMFKKRRKEQ IMQGLDHQLRTRKFKRIAFLTRSNRSFKKS Sbjct: 539 SYKLINELEQMFKKRRKEQGIMQGLDHQLRTRKFKRIAFLTRSNRSFKKS 588 Score = 81.6 bits (200), Expect(3) = 6e-46 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = +3 Query: 3 KENSIENCTEPSEINKIHDILLHYPTFPESEQKIEISEKNK*KL 134 KENSIENCTEPSEINKIHDILL YPTFPESEQKIEISEK + K+ Sbjct: 457 KENSIENCTEPSEINKIHDILLPYPTFPESEQKIEISEKKQVKI 500 Score = 52.4 bits (124), Expect(3) = 6e-46 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +2 Query: 116 KKQVKIDSNNRLKFSLNAILTNPKR 190 KKQVKIDSNNRLKFSLNAILTNPKR Sbjct: 495 KKQVKIDSNNRLKFSLNAILTNPKR 519 >gb|ARU07869.1| Ycf1 (chloroplast) [Artemisia gmelinii] Length = 1675 Score = 99.0 bits (245), Expect(3) = 6e-46 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +1 Query: 250 SYKLINELEQMFKKRRKEQSIMQGLDHQLRTRKFKRIAFLTRSNRSFKKS 399 SYKLINELEQMFKKRRKEQ IMQGLDHQLRTRKFKRIAFLTRSNRSFKKS Sbjct: 539 SYKLINELEQMFKKRRKEQGIMQGLDHQLRTRKFKRIAFLTRSNRSFKKS 588 Score = 81.6 bits (200), Expect(3) = 6e-46 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = +3 Query: 3 KENSIENCTEPSEINKIHDILLHYPTFPESEQKIEISEKNK*KL 134 KENSIENCTEPSEINKIHDILL YPTFPESEQKIEISEK + K+ Sbjct: 457 KENSIENCTEPSEINKIHDILLPYPTFPESEQKIEISEKKQVKI 500 Score = 52.4 bits (124), Expect(3) = 6e-46 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +2 Query: 116 KKQVKIDSNNRLKFSLNAILTNPKR 190 KKQVKIDSNNRLKFSLNAILTNPKR Sbjct: 495 KKQVKIDSNNRLKFSLNAILTNPKR 519 >ref|YP_009307812.1| Ycf1 (chloroplast) [Artemisia gmelinii] gb|AOR82645.1| Ycf1 (chloroplast) [Artemisia gmelinii] Length = 1675 Score = 99.0 bits (245), Expect(3) = 6e-46 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +1 Query: 250 SYKLINELEQMFKKRRKEQSIMQGLDHQLRTRKFKRIAFLTRSNRSFKKS 399 SYKLINELEQMFKKRRKEQ IMQGLDHQLRTRKFKRIAFLTRSNRSFKKS Sbjct: 539 SYKLINELEQMFKKRRKEQGIMQGLDHQLRTRKFKRIAFLTRSNRSFKKS 588 Score = 81.6 bits (200), Expect(3) = 6e-46 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = +3 Query: 3 KENSIENCTEPSEINKIHDILLHYPTFPESEQKIEISEKNK*KL 134 KENSIENCTEPSEINKIHDILL YPTFPESEQKIEISEK + K+ Sbjct: 457 KENSIENCTEPSEINKIHDILLPYPTFPESEQKIEISEKKQVKI 500 Score = 52.4 bits (124), Expect(3) = 6e-46 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +2 Query: 116 KKQVKIDSNNRLKFSLNAILTNPKR 190 KKQVKIDSNNRLKFSLNAILTNPKR Sbjct: 495 KKQVKIDSNNRLKFSLNAILTNPKR 519 >gb|AVI25957.1| photosystem I assembly protein Ycf1 (chloroplast) [Chrysanthemum boreale] Length = 1036 Score = 98.2 bits (243), Expect(3) = 2e-45 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +1 Query: 250 SYKLINELEQMFKKRRKEQSIMQGLDHQLRTRKFKRIAFLTRSNRSFKKS 399 SYKLINELEQMFKKRRKEQSIMQGLDHQLRTRKFKRIAFLTRS RSFKKS Sbjct: 538 SYKLINELEQMFKKRRKEQSIMQGLDHQLRTRKFKRIAFLTRSKRSFKKS 587 Score = 81.6 bits (200), Expect(3) = 2e-45 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = +3 Query: 3 KENSIENCTEPSEINKIHDILLHYPTFPESEQKIEISEKNK*KL 134 KENSIENCTEPSEINKIHDILL YPTFPESEQKIEISEK + K+ Sbjct: 456 KENSIENCTEPSEINKIHDILLPYPTFPESEQKIEISEKKQVKI 499 Score = 51.6 bits (122), Expect(3) = 2e-45 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +2 Query: 116 KKQVKIDSNNRLKFSLNAILTNPKR 190 KKQVKIDSNNRLKFSLNAI+TNPKR Sbjct: 494 KKQVKIDSNNRLKFSLNAIITNPKR 518 >ref|YP_009365300.1| Ycf1 protein (plastid) [Artemisia annua] gb|ARJ60743.1| Ycf1 protein (plastid) [Artemisia annua] Length = 1675 Score = 96.7 bits (239), Expect(3) = 3e-45 Identities = 48/50 (96%), Positives = 48/50 (96%) Frame = +1 Query: 250 SYKLINELEQMFKKRRKEQSIMQGLDHQLRTRKFKRIAFLTRSNRSFKKS 399 SYKLINELEQMFKKRRKEQ IMQGLDHQLRTRKFKRIAFLTRS RSFKKS Sbjct: 539 SYKLINELEQMFKKRRKEQGIMQGLDHQLRTRKFKRIAFLTRSKRSFKKS 588 Score = 81.6 bits (200), Expect(3) = 3e-45 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = +3 Query: 3 KENSIENCTEPSEINKIHDILLHYPTFPESEQKIEISEKNK*KL 134 KENSIENCTEPSEINKIHDILL YPTFPESEQKIEISEK + K+ Sbjct: 457 KENSIENCTEPSEINKIHDILLPYPTFPESEQKIEISEKKQVKI 500 Score = 52.4 bits (124), Expect(3) = 3e-45 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +2 Query: 116 KKQVKIDSNNRLKFSLNAILTNPKR 190 KKQVKIDSNNRLKFSLNAILTNPKR Sbjct: 495 KKQVKIDSNNRLKFSLNAILTNPKR 519 >gb|ANS11316.1| Ycf1 (chloroplast) [Artemisia fukudo] Length = 1675 Score = 96.7 bits (239), Expect(3) = 3e-45 Identities = 48/50 (96%), Positives = 48/50 (96%) Frame = +1 Query: 250 SYKLINELEQMFKKRRKEQSIMQGLDHQLRTRKFKRIAFLTRSNRSFKKS 399 SYKLINELEQMFKKRRKEQ IMQGLDHQLRTRKFKRIAFLTRS RSFKKS Sbjct: 539 SYKLINELEQMFKKRRKEQGIMQGLDHQLRTRKFKRIAFLTRSKRSFKKS 588 Score = 81.6 bits (200), Expect(3) = 3e-45 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = +3 Query: 3 KENSIENCTEPSEINKIHDILLHYPTFPESEQKIEISEKNK*KL 134 KENSIENCTEPSEINKIHDILL YPTFPESEQKIEISEK + K+ Sbjct: 457 KENSIENCTEPSEINKIHDILLPYPTFPESEQKIEISEKKQVKI 500 Score = 52.4 bits (124), Expect(3) = 3e-45 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +2 Query: 116 KKQVKIDSNNRLKFSLNAILTNPKR 190 KKQVKIDSNNRLKFSLNAILTNPKR Sbjct: 495 KKQVKIDSNNRLKFSLNAILTNPKR 519 >ref|YP_009307900.1| Ycf1 (chloroplast) [Artemisia capillaris] gb|AOR82733.1| Ycf1 (chloroplast) [Artemisia capillaris] gb|ARU07957.1| Ycf1 (chloroplast) [Artemisia capillaris] Length = 1666 Score = 94.7 bits (234), Expect(3) = 3e-43 Identities = 47/50 (94%), Positives = 47/50 (94%) Frame = +1 Query: 250 SYKLINELEQMFKKRRKEQSIMQGLDHQLRTRKFKRIAFLTRSNRSFKKS 399 SYKLINELEQMFKKRRKEQ IMQGLDHQLRTRKFK IAFLTRS RSFKKS Sbjct: 537 SYKLINELEQMFKKRRKEQGIMQGLDHQLRTRKFKHIAFLTRSKRSFKKS 586 Score = 76.6 bits (187), Expect(3) = 3e-43 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = +3 Query: 3 KENSIENCTEPSEINKIHDILLHYPTFPESEQKIEISEKNK*KL 134 KENSIENCTE SEINKIHD+LL YPTFPESEQKIEISEK + K+ Sbjct: 455 KENSIENCTELSEINKIHDMLLPYPTFPESEQKIEISEKKQVKI 498 Score = 52.4 bits (124), Expect(3) = 3e-43 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +2 Query: 116 KKQVKIDSNNRLKFSLNAILTNPKR 190 KKQVKIDSNNRLKFSLNAILTNPKR Sbjct: 493 KKQVKIDSNNRLKFSLNAILTNPKR 517 >ref|YP_009377192.1| hypothetical chloroplast RF1 (chloroplast) [Parastrephia quadrangularis] gb|ARH08608.1| hypothetical chloroplast RF1 (chloroplast) [Parastrephia quadrangularis] Length = 1687 Score = 92.4 bits (228), Expect(3) = 6e-37 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = +1 Query: 250 SYKLINELEQMFKKRRKEQSIMQGLDHQLRTRKFKRIAFLTRSNRSFKKS 399 SYKLINELEQ FKKRRKEQ +MQGLDHQLRTR+FKRIAFLTRS RSFKKS Sbjct: 554 SYKLINELEQHFKKRRKEQGVMQGLDHQLRTRRFKRIAFLTRSRRSFKKS 603 Score = 57.8 bits (138), Expect(3) = 6e-37 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = +3 Query: 6 ENSIENCTEPSEINKIHDILLHYPTFPESEQKIEISEKNK*KL 134 E SIENCTE SE+N+IHDILL Y PE EQK+E SEK + K+ Sbjct: 475 ETSIENCTETSELNQIHDILLPYSNSPEYEQKMERSEKKQVKI 517 Score = 52.4 bits (124), Expect(3) = 6e-37 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +2 Query: 116 KKQVKIDSNNRLKFSLNAILTNPKR 190 KKQVKIDSNNRLKFSLNAILTNPKR Sbjct: 512 KKQVKIDSNNRLKFSLNAILTNPKR 536 >ref|YP_009375407.1| hypothetical chloroplast RF1 (chloroplast) [Diplostephium cinereum] gb|ARH05718.1| hypothetical chloroplast RF1 (chloroplast) [Diplostephium cinereum] Length = 1687 Score = 92.0 bits (227), Expect(3) = 8e-37 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = +1 Query: 250 SYKLINELEQMFKKRRKEQSIMQGLDHQLRTRKFKRIAFLTRSNRSFKKS 399 SYKLINELEQ FKKRRKEQ +MQGLDHQLRTR+FKRIAFLTRS RSFKKS Sbjct: 554 SYKLINELEQHFKKRRKEQGLMQGLDHQLRTRRFKRIAFLTRSRRSFKKS 603 Score = 57.8 bits (138), Expect(3) = 8e-37 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = +3 Query: 6 ENSIENCTEPSEINKIHDILLHYPTFPESEQKIEISEKNK*KL 134 E SIENCTE SE+N+IHDILL Y PE EQK+E SEK + K+ Sbjct: 475 ETSIENCTETSELNQIHDILLPYSNSPEYEQKMERSEKKQVKI 517 Score = 52.4 bits (124), Expect(3) = 8e-37 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +2 Query: 116 KKQVKIDSNNRLKFSLNAILTNPKR 190 KKQVKIDSNNRLKFSLNAILTNPKR Sbjct: 512 KKQVKIDSNNRLKFSLNAILTNPKR 536 >ref|YP_009255922.1| hypothetical chloroplast RF1 (chloroplast) [Helianthus argophyllus] gb|ANF03727.1| hypothetical chloroplast RF1 (chloroplast) [Helianthus argophyllus] Length = 1705 Score = 92.4 bits (228), Expect(3) = 2e-36 Identities = 46/50 (92%), Positives = 46/50 (92%) Frame = +1 Query: 250 SYKLINELEQMFKKRRKEQSIMQGLDHQLRTRKFKRIAFLTRSNRSFKKS 399 SYKLINELEQ FKKRRKEQ IMQGLDHQLRTRKFK IAFLTRS RSFKKS Sbjct: 556 SYKLINELEQYFKKRRKEQGIMQGLDHQLRTRKFKHIAFLTRSERSFKKS 605 Score = 65.1 bits (157), Expect(3) = 2e-36 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 6 ENSIENCTEPSEINKIHDILLHYPTFPESEQKIEISEKNK*KL 134 E SIENCTE +E+NKIHDILL YP PE+EQKIE SEK K K+ Sbjct: 477 ETSIENCTETAELNKIHDILLPYPNSPENEQKIERSEKKKRKI 519 Score = 43.5 bits (101), Expect(3) = 2e-36 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = +2 Query: 116 KKQVKIDSNNRLKFSLNAILTNPKR 190 KK+ KIDSNN LKFSLN ILTNPKR Sbjct: 514 KKKRKIDSNNGLKFSLNEILTNPKR 538 >ref|YP_588165.1| hypothetical chloroplast RF1 (chloroplast) [Helianthus annuus] sp|Q1KXR1.1|TI214_HELAN RecName: Full=Protein TIC 214; AltName: Full=Translocon at the inner envelope membrane of chloroplasts 214; Short=AtTIC214 gb|ABD47193.1| hypothetical chloroplast RF1 (chloroplast) [Helianthus annuus] gb|ANB79045.1| hypothetical chloroplast RF19 (chloroplast) [Helianthus annuus subsp. texanus] Length = 1705 Score = 92.4 bits (228), Expect(3) = 2e-36 Identities = 46/50 (92%), Positives = 46/50 (92%) Frame = +1 Query: 250 SYKLINELEQMFKKRRKEQSIMQGLDHQLRTRKFKRIAFLTRSNRSFKKS 399 SYKLINELEQ FKKRRKEQ IMQGLDHQLRTRKFK IAFLTRS RSFKKS Sbjct: 556 SYKLINELEQYFKKRRKEQGIMQGLDHQLRTRKFKHIAFLTRSERSFKKS 605 Score = 65.1 bits (157), Expect(3) = 2e-36 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 6 ENSIENCTEPSEINKIHDILLHYPTFPESEQKIEISEKNK*KL 134 E SIENCTE +E+NKIHDILL YP PE+EQKIE SEK K K+ Sbjct: 477 ETSIENCTETAELNKIHDILLPYPNSPENEQKIERSEKKKRKI 519 Score = 43.5 bits (101), Expect(3) = 2e-36 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = +2 Query: 116 KKQVKIDSNNRLKFSLNAILTNPKR 190 KK+ KIDSNN LKFSLN ILTNPKR Sbjct: 514 KKKRKIDSNNGLKFSLNEILTNPKR 538 >gb|AVN90138.1| hypothetical chloroplast RF19 (chloroplast) [Helianthus tuberosus] Length = 1698 Score = 92.4 bits (228), Expect(3) = 2e-36 Identities = 46/50 (92%), Positives = 46/50 (92%) Frame = +1 Query: 250 SYKLINELEQMFKKRRKEQSIMQGLDHQLRTRKFKRIAFLTRSNRSFKKS 399 SYKLINELEQ FKKRRKEQ IMQGLDHQLRTRKFK IAFLTRS RSFKKS Sbjct: 549 SYKLINELEQYFKKRRKEQGIMQGLDHQLRTRKFKHIAFLTRSERSFKKS 598 Score = 65.1 bits (157), Expect(3) = 2e-36 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 6 ENSIENCTEPSEINKIHDILLHYPTFPESEQKIEISEKNK*KL 134 E SIENCTE +E+NKIHDILL YP PE+EQKIE SEK K K+ Sbjct: 470 ETSIENCTETAELNKIHDILLPYPNSPENEQKIERSEKKKRKI 512 Score = 43.5 bits (101), Expect(3) = 2e-36 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = +2 Query: 116 KKQVKIDSNNRLKFSLNAILTNPKR 190 KK+ KIDSNN LKFSLN ILTNPKR Sbjct: 507 KKKRKIDSNNGLKFSLNEILTNPKR 531 >gb|AHB16970.1| hypothetical chloroplast RF19 (plastid) [Helianthus hirsutus] Length = 1697 Score = 92.4 bits (228), Expect(3) = 2e-36 Identities = 46/50 (92%), Positives = 46/50 (92%) Frame = +1 Query: 250 SYKLINELEQMFKKRRKEQSIMQGLDHQLRTRKFKRIAFLTRSNRSFKKS 399 SYKLINELEQ FKKRRKEQ IMQGLDHQLRTRKFK IAFLTRS RSFKKS Sbjct: 548 SYKLINELEQYFKKRRKEQGIMQGLDHQLRTRKFKHIAFLTRSERSFKKS 597 Score = 65.1 bits (157), Expect(3) = 2e-36 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 6 ENSIENCTEPSEINKIHDILLHYPTFPESEQKIEISEKNK*KL 134 E SIENCTE +E+NKIHDILL YP PE+EQKIE SEK K K+ Sbjct: 469 ETSIENCTETAELNKIHDILLPYPNSPENEQKIERSEKKKRKI 511 Score = 43.5 bits (101), Expect(3) = 2e-36 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = +2 Query: 116 KKQVKIDSNNRLKFSLNAILTNPKR 190 KK+ KIDSNN LKFSLN ILTNPKR Sbjct: 506 KKKRKIDSNNGLKFSLNEILTNPKR 530 >gb|AHB16545.1| hypothetical chloroplast RF19 (plastid) [Helianthus grosseserratus] Length = 1697 Score = 92.4 bits (228), Expect(3) = 2e-36 Identities = 46/50 (92%), Positives = 46/50 (92%) Frame = +1 Query: 250 SYKLINELEQMFKKRRKEQSIMQGLDHQLRTRKFKRIAFLTRSNRSFKKS 399 SYKLINELEQ FKKRRKEQ IMQGLDHQLRTRKFK IAFLTRS RSFKKS Sbjct: 548 SYKLINELEQYFKKRRKEQGIMQGLDHQLRTRKFKHIAFLTRSERSFKKS 597 Score = 65.1 bits (157), Expect(3) = 2e-36 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 6 ENSIENCTEPSEINKIHDILLHYPTFPESEQKIEISEKNK*KL 134 E SIENCTE +E+NKIHDILL YP PE+EQKIE SEK K K+ Sbjct: 469 ETSIENCTETAELNKIHDILLPYPNSPENEQKIERSEKKKRKI 511 Score = 43.5 bits (101), Expect(3) = 2e-36 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = +2 Query: 116 KKQVKIDSNNRLKFSLNAILTNPKR 190 KK+ KIDSNN LKFSLN ILTNPKR Sbjct: 506 KKKRKIDSNNGLKFSLNEILTNPKR 530 >gb|AHB16205.1| hypothetical chloroplast RF19 (plastid) [Helianthus giganteus] Length = 1697 Score = 92.4 bits (228), Expect(3) = 2e-36 Identities = 46/50 (92%), Positives = 46/50 (92%) Frame = +1 Query: 250 SYKLINELEQMFKKRRKEQSIMQGLDHQLRTRKFKRIAFLTRSNRSFKKS 399 SYKLINELEQ FKKRRKEQ IMQGLDHQLRTRKFK IAFLTRS RSFKKS Sbjct: 548 SYKLINELEQYFKKRRKEQGIMQGLDHQLRTRKFKHIAFLTRSERSFKKS 597 Score = 65.1 bits (157), Expect(3) = 2e-36 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 6 ENSIENCTEPSEINKIHDILLHYPTFPESEQKIEISEKNK*KL 134 E SIENCTE +E+NKIHDILL YP PE+EQKIE SEK K K+ Sbjct: 469 ETSIENCTETAELNKIHDILLPYPNSPENEQKIERSEKKKRKI 511 Score = 43.5 bits (101), Expect(3) = 2e-36 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = +2 Query: 116 KKQVKIDSNNRLKFSLNAILTNPKR 190 KK+ KIDSNN LKFSLN ILTNPKR Sbjct: 506 KKKRKIDSNNGLKFSLNEILTNPKR 530 >ref|YP_008964659.1| hypothetical chloroplast RF19 [Helianthus tuberosus] gb|AHB15780.1| hypothetical chloroplast RF19 (plastid) [Helianthus tuberosus] Length = 1697 Score = 92.4 bits (228), Expect(3) = 2e-36 Identities = 46/50 (92%), Positives = 46/50 (92%) Frame = +1 Query: 250 SYKLINELEQMFKKRRKEQSIMQGLDHQLRTRKFKRIAFLTRSNRSFKKS 399 SYKLINELEQ FKKRRKEQ IMQGLDHQLRTRKFK IAFLTRS RSFKKS Sbjct: 548 SYKLINELEQYFKKRRKEQGIMQGLDHQLRTRKFKHIAFLTRSERSFKKS 597 Score = 65.1 bits (157), Expect(3) = 2e-36 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 6 ENSIENCTEPSEINKIHDILLHYPTFPESEQKIEISEKNK*KL 134 E SIENCTE +E+NKIHDILL YP PE+EQKIE SEK K K+ Sbjct: 469 ETSIENCTETAELNKIHDILLPYPNSPENEQKIERSEKKKRKI 511 Score = 43.5 bits (101), Expect(3) = 2e-36 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = +2 Query: 116 KKQVKIDSNNRLKFSLNAILTNPKR 190 KK+ KIDSNN LKFSLN ILTNPKR Sbjct: 506 KKKRKIDSNNGLKFSLNEILTNPKR 530 >gb|AHB15440.1| hypothetical chloroplast RF19 (plastid) [Helianthus decapetalus] Length = 1697 Score = 92.4 bits (228), Expect(3) = 2e-36 Identities = 46/50 (92%), Positives = 46/50 (92%) Frame = +1 Query: 250 SYKLINELEQMFKKRRKEQSIMQGLDHQLRTRKFKRIAFLTRSNRSFKKS 399 SYKLINELEQ FKKRRKEQ IMQGLDHQLRTRKFK IAFLTRS RSFKKS Sbjct: 548 SYKLINELEQYFKKRRKEQGIMQGLDHQLRTRKFKHIAFLTRSERSFKKS 597 Score = 65.1 bits (157), Expect(3) = 2e-36 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 6 ENSIENCTEPSEINKIHDILLHYPTFPESEQKIEISEKNK*KL 134 E SIENCTE +E+NKIHDILL YP PE+EQKIE SEK K K+ Sbjct: 469 ETSIENCTETAELNKIHDILLPYPNSPENEQKIERSEKKKRKI 511 Score = 43.5 bits (101), Expect(3) = 2e-36 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = +2 Query: 116 KKQVKIDSNNRLKFSLNAILTNPKR 190 KK+ KIDSNN LKFSLN ILTNPKR Sbjct: 506 KKKRKIDSNNGLKFSLNEILTNPKR 530 >ref|YP_008964489.1| hypothetical chloroplast RF19 [Helianthus decapetalus] gb|AHB15355.1| hypothetical chloroplast RF19 (plastid) [Helianthus decapetalus] Length = 1697 Score = 92.4 bits (228), Expect(3) = 2e-36 Identities = 46/50 (92%), Positives = 46/50 (92%) Frame = +1 Query: 250 SYKLINELEQMFKKRRKEQSIMQGLDHQLRTRKFKRIAFLTRSNRSFKKS 399 SYKLINELEQ FKKRRKEQ IMQGLDHQLRTRKFK IAFLTRS RSFKKS Sbjct: 548 SYKLINELEQYFKKRRKEQGIMQGLDHQLRTRKFKHIAFLTRSERSFKKS 597 Score = 65.1 bits (157), Expect(3) = 2e-36 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 6 ENSIENCTEPSEINKIHDILLHYPTFPESEQKIEISEKNK*KL 134 E SIENCTE +E+NKIHDILL YP PE+EQKIE SEK K K+ Sbjct: 469 ETSIENCTETAELNKIHDILLPYPNSPENEQKIERSEKKKRKI 511 Score = 43.5 bits (101), Expect(3) = 2e-36 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = +2 Query: 116 KKQVKIDSNNRLKFSLNAILTNPKR 190 KK+ KIDSNN LKFSLN ILTNPKR Sbjct: 506 KKKRKIDSNNGLKFSLNEILTNPKR 530