BLASTX nr result
ID: Chrysanthemum21_contig00032122
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00032122 (398 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI11453.1| F-box domain, cyclin-like protein [Cynara cardunc... 79 1e-14 ref|XP_022018569.1| F-box/WD-40 repeat-containing protein At5g21... 68 2e-10 >gb|KVI11453.1| F-box domain, cyclin-like protein [Cynara cardunculus var. scolymus] Length = 487 Score = 79.3 bits (194), Expect = 1e-14 Identities = 39/50 (78%), Positives = 44/50 (88%) Frame = +3 Query: 225 MAFECKTSTKIILSKNSEDTTQVNLNHIVSSGKSLLIDSESVITESGKPR 374 MAFECK ST+I L+KNSEDT +V +HIVSSGKSLL DSE+VITESGKPR Sbjct: 1 MAFECKVSTEIYLTKNSEDTIEVKPSHIVSSGKSLLFDSETVITESGKPR 50 >ref|XP_022018569.1| F-box/WD-40 repeat-containing protein At5g21040 [Helianthus annuus] gb|OTF91346.1| putative F-box protein 2 [Helianthus annuus] Length = 544 Score = 67.8 bits (164), Expect = 2e-10 Identities = 36/58 (62%), Positives = 45/58 (77%) Frame = +3 Query: 225 MAFECKTSTKIILSKNSEDTTQVNLNHIVSSGKSLLIDSESVITESGKPRQSSKLPAD 398 MAFECK +T I ++K+SE V+ NHIVSSGKSL+IDSE+V+T SGK S+KLP D Sbjct: 1 MAFECKVNTDIAVTKDSE----VDSNHIVSSGKSLVIDSETVVTNSGKLIHSAKLPID 54