BLASTX nr result
ID: Chrysanthemum21_contig00031992
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00031992 (925 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG36834.1| putative zinc finger, CCHC-type [Helianthus annuus] 59 4e-06 gb|OTG07615.1| putative S-locus glycoprotein domain, Bulb-type l... 59 5e-06 >gb|OTG36834.1| putative zinc finger, CCHC-type [Helianthus annuus] Length = 309 Score = 58.5 bits (140), Expect = 4e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +1 Query: 478 NVTHQCPKPNESHYTTWAIMMETILKVCGLWETLKATEGGDPK 606 NV+ QCPK E++YT WA+MMETILK LWET+ +TEG + K Sbjct: 16 NVSLQCPKLKEANYTQWAVMMETILKAYSLWETVVSTEGINEK 58 >gb|OTG07615.1| putative S-locus glycoprotein domain, Bulb-type lectin domain, Zinc finger, CCHC-type [Helianthus annuus] Length = 554 Score = 58.9 bits (141), Expect = 5e-06 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = +1 Query: 466 NREQNVTHQCPKPNESHYTTWAIMMETILKVCGLWETLKATEGGDPK 606 + + NV+ QCPK E++YT WA+MMETILK LWET+ +TEG + K Sbjct: 134 HEQGNVSLQCPKLKETNYTQWAVMMETILKAYSLWETVVSTEGINEK 180