BLASTX nr result
ID: Chrysanthemum21_contig00031873
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00031873 (522 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021972286.1| F-box/FBD/LRR-repeat protein At1g13570-like ... 40 4e-06 >ref|XP_021972286.1| F-box/FBD/LRR-repeat protein At1g13570-like [Helianthus annuus] ref|XP_021972287.1| F-box/FBD/LRR-repeat protein At1g13570-like [Helianthus annuus] ref|XP_021972288.1| F-box/FBD/LRR-repeat protein At1g13570-like [Helianthus annuus] ref|XP_021972289.1| F-box/FBD/LRR-repeat protein At1g13570-like [Helianthus annuus] gb|OTG19842.1| putative F-box domain, Leucine-rich repeat domain, L domain-like protein [Helianthus annuus] Length = 386 Score = 40.0 bits (92), Expect(3) = 4e-06 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%) Frame = +1 Query: 169 LTL*TAEMSLIVATIPPSLTYLNVIPVIESLTVPICILQSFVHDR----VPPA*IHLKYF 336 LTL A + + + L +PVIE L V ++ F+ R +P A +HLKY Sbjct: 203 LTLDNASTFICDDEVTTIVDLLECLPVIEYLYVVFSFVEDFLRWRHPKELPTALVHLKYL 262 Query: 337 HTNEISFTHKDGLSFFVL 390 +++SF+H GL F L Sbjct: 263 CIHDLSFSHIYGLPFLAL 280 Score = 28.9 bits (63), Expect(3) = 4e-06 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +2 Query: 107 YATRLSLFSFRLLTILCLSGSSLYEQQ 187 Y +SLFS LT L LSG +LY+Q+ Sbjct: 141 YKLPISLFSLHQLTSLYLSGCALYQQR 167 Score = 28.5 bits (62), Expect(3) = 4e-06 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +3 Query: 378 FFCAFLRNSPSLEKLKIENKVFDQDDSSMEDDLCTEDEIYSFTVDSY 518 F +R+SP+LEKLK+ M D+ E E+ SFT++ Y Sbjct: 277 FLALLIRSSPNLEKLKL----------VMYDEDLEEYEMGSFTLEDY 313