BLASTX nr result
ID: Chrysanthemum21_contig00031436
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00031436 (846 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022035205.1| uncharacterized protein LOC110937104 [Helian... 44 7e-06 >ref|XP_022035205.1| uncharacterized protein LOC110937104 [Helianthus annuus] Length = 343 Score = 43.5 bits (101), Expect(2) = 7e-06 Identities = 31/106 (29%), Positives = 55/106 (51%), Gaps = 5/106 (4%) Frame = +1 Query: 13 LPDLNVDNTPMRKRKGKKAETESSTINS--VAASFDTYTTNKT--QLLQ-EAVATKVAKN 177 +PD+N D +P R ++ K + SS +S +AA F YT K Q ++ EA+ + + Sbjct: 226 IPDINEDPSPQRAQRRDKRQATSSEGSSAELAAQFKVYTAMKEAKQAVELEAIELRKKRE 285 Query: 178 QMSHPQYYPQIALMEEKHMWKALKFYTEPHDNITDPNILAFTLGKK 315 S QI M+ + + +K + +PHD++ P++L L +K Sbjct: 286 SESRELISVQIETMKNYNYDRDMKTFLKPHDDV-PPSMLPIILARK 330 Score = 35.4 bits (80), Expect(2) = 7e-06 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = +2 Query: 302 LLAKKRELAAKYGWTCDF 355 +LA+KRE+A KYGW CDF Sbjct: 326 ILARKREIANKYGWPCDF 343