BLASTX nr result
ID: Chrysanthemum21_contig00031383
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00031383 (476 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI05502.1| Actin-binding FH2 [Cynara cardunculus var. scolymus] 59 6e-07 >gb|KVI05502.1| Actin-binding FH2 [Cynara cardunculus var. scolymus] Length = 1514 Score = 58.5 bits (140), Expect = 6e-07 Identities = 28/43 (65%), Positives = 31/43 (72%), Gaps = 7/43 (16%) Frame = -3 Query: 111 GNSRRNMKFTPGTYT-------DHSRFNQTPLPYSPLRTNASY 4 GNSR NM FTPGTYT DHSRFNQTPLP++ RT+ SY Sbjct: 297 GNSRSNMNFTPGTYTEISTRIQDHSRFNQTPLPFATSRTSGSY 339