BLASTX nr result
ID: Chrysanthemum21_contig00031264
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00031264 (390 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI06365.1| Pentatricopeptide repeat-containing protein [Cyna... 143 4e-37 ref|XP_008356673.2| PREDICTED: pentatricopeptide repeat-containi... 142 6e-37 ref|XP_008346758.1| PREDICTED: pentatricopeptide repeat-containi... 142 8e-37 ref|XP_010272206.1| PREDICTED: pentatricopeptide repeat-containi... 142 8e-37 ref|XP_020548243.1| LOW QUALITY PROTEIN: pentatricopeptide repea... 141 2e-36 emb|CDP14888.1| unnamed protein product [Coffea canephora] 140 4e-36 ref|XP_009343436.1| PREDICTED: pentatricopeptide repeat-containi... 140 5e-36 ref|XP_009369368.1| PREDICTED: pentatricopeptide repeat-containi... 140 5e-36 ref|XP_021983949.1| pentatricopeptide repeat-containing protein ... 140 7e-36 gb|PIN07708.1| hypothetical protein CDL12_19718 [Handroanthus im... 140 7e-36 ref|XP_022135050.1| pentatricopeptide repeat-containing protein ... 140 7e-36 gb|OTG16430.1| putative pentatricopeptide repeat (PPR) superfami... 140 7e-36 ref|XP_021808393.1| pentatricopeptide repeat-containing protein ... 139 1e-35 ref|XP_008239656.1| PREDICTED: pentatricopeptide repeat-containi... 139 1e-35 ref|XP_007210374.1| pentatricopeptide repeat-containing protein ... 139 1e-35 ref|XP_018831595.1| PREDICTED: pentatricopeptide repeat-containi... 139 1e-35 gb|PKI78031.1| hypothetical protein CRG98_001651 [Punica granatum] 137 1e-35 ref|XP_017236253.1| PREDICTED: pentatricopeptide repeat-containi... 139 2e-35 ref|XP_010112585.1| pentatricopeptide repeat-containing protein ... 139 2e-35 ref|XP_015879483.1| PREDICTED: pentatricopeptide repeat-containi... 132 2e-35 >gb|KVI06365.1| Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 861 Score = 143 bits (361), Expect = 4e-37 Identities = 67/72 (93%), Positives = 69/72 (95%) Frame = -1 Query: 390 GVCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRW 211 GVCPSRIDIVTGWGRRSRVTG+SLVRQSVQELLNIF FPFFTENGN+GCFVGCGEPL RW Sbjct: 790 GVCPSRIDIVTGWGRRSRVTGSSLVRQSVQELLNIFGFPFFTENGNTGCFVGCGEPLSRW 849 Query: 210 LDQSYVERMHLL 175 L QSYVERMHLL Sbjct: 850 LVQSYVERMHLL 861 >ref|XP_008356673.2| PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Malus domestica] Length = 710 Score = 142 bits (359), Expect = 6e-37 Identities = 65/72 (90%), Positives = 70/72 (97%) Frame = -1 Query: 390 GVCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRW 211 G+CPSRIDIVTGWGRRSRVTG+SLVRQ+VQELLN+F+FPFFTENGNSGCFVGCGEPL RW Sbjct: 639 GICPSRIDIVTGWGRRSRVTGSSLVRQAVQELLNVFRFPFFTENGNSGCFVGCGEPLNRW 698 Query: 210 LDQSYVERMHLL 175 L QSYVERMHLL Sbjct: 699 LLQSYVERMHLL 710 >ref|XP_008346758.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like [Malus domestica] ref|XP_017180880.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like [Malus domestica] ref|XP_017180881.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like [Malus domestica] Length = 874 Score = 142 bits (359), Expect = 8e-37 Identities = 65/72 (90%), Positives = 70/72 (97%) Frame = -1 Query: 390 GVCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRW 211 G+CPSRIDIVTGWGRRSRVTG+SLVRQ+VQELLN+F+FPFFTENGNSGCFVGCGEPL RW Sbjct: 803 GICPSRIDIVTGWGRRSRVTGSSLVRQAVQELLNVFRFPFFTENGNSGCFVGCGEPLNRW 862 Query: 210 LDQSYVERMHLL 175 L QSYVERMHLL Sbjct: 863 LLQSYVERMHLL 874 >ref|XP_010272206.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Nelumbo nucifera] Length = 880 Score = 142 bits (359), Expect = 8e-37 Identities = 67/72 (93%), Positives = 69/72 (95%) Frame = -1 Query: 390 GVCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRW 211 G+ PSRIDIVTGWGRRSRVTG+SLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPL RW Sbjct: 809 GISPSRIDIVTGWGRRSRVTGSSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLSRW 868 Query: 210 LDQSYVERMHLL 175 L QSYVERMHLL Sbjct: 869 LLQSYVERMHLL 880 >ref|XP_020548243.1| LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g74750-like [Sesamum indicum] Length = 856 Score = 141 bits (356), Expect = 2e-36 Identities = 64/72 (88%), Positives = 70/72 (97%) Frame = -1 Query: 390 GVCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRW 211 G+CP+RIDIVTGWGRRSRVTGTSLVRQ+VQELLN+F+FPFFTENGNSGCFVGCGEPL +W Sbjct: 785 GICPTRIDIVTGWGRRSRVTGTSLVRQAVQELLNMFRFPFFTENGNSGCFVGCGEPLSQW 844 Query: 210 LDQSYVERMHLL 175 L QSYVERMHLL Sbjct: 845 LLQSYVERMHLL 856 >emb|CDP14888.1| unnamed protein product [Coffea canephora] Length = 864 Score = 140 bits (354), Expect = 4e-36 Identities = 64/72 (88%), Positives = 68/72 (94%) Frame = -1 Query: 390 GVCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRW 211 G+CPSRIDIVTGWGRRSRVTG+SLVRQ+VQELLN+F FPF TENGNSGCFVGCGEPL RW Sbjct: 793 GICPSRIDIVTGWGRRSRVTGSSLVRQAVQELLNVFSFPFVTENGNSGCFVGCGEPLSRW 852 Query: 210 LDQSYVERMHLL 175 L QSYVERMHLL Sbjct: 853 LVQSYVERMHLL 864 >ref|XP_009343436.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Pyrus x bretschneideri] ref|XP_009343437.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Pyrus x bretschneideri] Length = 862 Score = 140 bits (353), Expect = 5e-36 Identities = 64/72 (88%), Positives = 68/72 (94%) Frame = -1 Query: 390 GVCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRW 211 G+CPSRIDIVTGWGRRSRVTG+SLVRQ+VQELLN F FPFFTENGNSGCF+GCGEPL RW Sbjct: 791 GICPSRIDIVTGWGRRSRVTGSSLVRQAVQELLNAFHFPFFTENGNSGCFIGCGEPLNRW 850 Query: 210 LDQSYVERMHLL 175 L QSYVERMHLL Sbjct: 851 LLQSYVERMHLL 862 >ref|XP_009369368.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like [Pyrus x bretschneideri] ref|XP_009369369.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like [Pyrus x bretschneideri] ref|XP_009369370.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like [Pyrus x bretschneideri] Length = 870 Score = 140 bits (353), Expect = 5e-36 Identities = 64/72 (88%), Positives = 69/72 (95%) Frame = -1 Query: 390 GVCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRW 211 G+CPSRIDIVTGWGRRSRVTG+SLVRQ+VQELL +F+FPFFTENGNSGCFVGCGEPL RW Sbjct: 799 GICPSRIDIVTGWGRRSRVTGSSLVRQAVQELLKVFRFPFFTENGNSGCFVGCGEPLNRW 858 Query: 210 LDQSYVERMHLL 175 L QSYVERMHLL Sbjct: 859 LLQSYVERMHLL 870 >ref|XP_021983949.1| pentatricopeptide repeat-containing protein At1g74750-like [Helianthus annuus] Length = 840 Score = 140 bits (352), Expect = 7e-36 Identities = 63/72 (87%), Positives = 69/72 (95%) Frame = -1 Query: 390 GVCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRW 211 G+CPSRIDIVTGWGRRSRVTG+SLVRQSV +LLNIF+FPFFTENGN+GCFVGCGEPL RW Sbjct: 769 GICPSRIDIVTGWGRRSRVTGSSLVRQSVHDLLNIFRFPFFTENGNTGCFVGCGEPLSRW 828 Query: 210 LDQSYVERMHLL 175 L +SYVERMHLL Sbjct: 829 LVESYVERMHLL 840 >gb|PIN07708.1| hypothetical protein CDL12_19718 [Handroanthus impetiginosus] Length = 856 Score = 140 bits (352), Expect = 7e-36 Identities = 64/72 (88%), Positives = 69/72 (95%) Frame = -1 Query: 390 GVCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRW 211 G+CPSRIDIVTGWGRRSRVTGTS+VRQ+VQELLN+F+FPFFTENGNSGCFVGCGE L RW Sbjct: 785 GICPSRIDIVTGWGRRSRVTGTSMVRQAVQELLNMFEFPFFTENGNSGCFVGCGESLNRW 844 Query: 210 LDQSYVERMHLL 175 L QSYVERMHLL Sbjct: 845 LLQSYVERMHLL 856 >ref|XP_022135050.1| pentatricopeptide repeat-containing protein At1g18900 [Momordica charantia] Length = 878 Score = 140 bits (352), Expect = 7e-36 Identities = 65/72 (90%), Positives = 68/72 (94%) Frame = -1 Query: 390 GVCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRW 211 GV PSRIDIVTGWGRRSRVTG+SLVRQ+VQ+LLNIF FPFFTENGNSGCFVGCGEPL RW Sbjct: 807 GVSPSRIDIVTGWGRRSRVTGSSLVRQAVQDLLNIFSFPFFTENGNSGCFVGCGEPLSRW 866 Query: 210 LDQSYVERMHLL 175 L QSYVERMHLL Sbjct: 867 LHQSYVERMHLL 878 >gb|OTG16430.1| putative pentatricopeptide repeat (PPR) superfamily protein [Helianthus annuus] Length = 907 Score = 140 bits (352), Expect = 7e-36 Identities = 63/72 (87%), Positives = 69/72 (95%) Frame = -1 Query: 390 GVCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRW 211 G+CPSRIDIVTGWGRRSRVTG+SLVRQSV +LLNIF+FPFFTENGN+GCFVGCGEPL RW Sbjct: 836 GICPSRIDIVTGWGRRSRVTGSSLVRQSVHDLLNIFRFPFFTENGNTGCFVGCGEPLSRW 895 Query: 210 LDQSYVERMHLL 175 L +SYVERMHLL Sbjct: 896 LVESYVERMHLL 907 >ref|XP_021808393.1| pentatricopeptide repeat-containing protein At1g18900 [Prunus avium] ref|XP_021808394.1| pentatricopeptide repeat-containing protein At1g18900 [Prunus avium] ref|XP_021808395.1| pentatricopeptide repeat-containing protein At1g18900 [Prunus avium] ref|XP_021808396.1| pentatricopeptide repeat-containing protein At1g18900 [Prunus avium] Length = 870 Score = 139 bits (350), Expect = 1e-35 Identities = 63/72 (87%), Positives = 69/72 (95%) Frame = -1 Query: 390 GVCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRW 211 G+CPSRIDIVTGWGRRSRVTG+SLVRQ+V+ELLN+F FPFFTENGNSGCFVGCGEPL +W Sbjct: 799 GICPSRIDIVTGWGRRSRVTGSSLVRQAVEELLNMFSFPFFTENGNSGCFVGCGEPLNKW 858 Query: 210 LDQSYVERMHLL 175 L QSYVERMHLL Sbjct: 859 LLQSYVERMHLL 870 >ref|XP_008239656.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18900 [Prunus mume] Length = 870 Score = 139 bits (350), Expect = 1e-35 Identities = 63/72 (87%), Positives = 69/72 (95%) Frame = -1 Query: 390 GVCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRW 211 G+CPSRIDIVTGWGRRSRVTG+SLVRQ+V+ELLN+F FPFFTENGNSGCFVGCGEPL +W Sbjct: 799 GICPSRIDIVTGWGRRSRVTGSSLVRQAVEELLNMFSFPFFTENGNSGCFVGCGEPLNKW 858 Query: 210 LDQSYVERMHLL 175 L QSYVERMHLL Sbjct: 859 LLQSYVERMHLL 870 >ref|XP_007210374.1| pentatricopeptide repeat-containing protein At1g18900 [Prunus persica] ref|XP_020419398.1| pentatricopeptide repeat-containing protein At1g18900 [Prunus persica] gb|ONI08547.1| hypothetical protein PRUPE_5G184700 [Prunus persica] gb|ONI08548.1| hypothetical protein PRUPE_5G184700 [Prunus persica] gb|ONI08549.1| hypothetical protein PRUPE_5G184700 [Prunus persica] gb|ONI08550.1| hypothetical protein PRUPE_5G184700 [Prunus persica] gb|ONI08551.1| hypothetical protein PRUPE_5G184700 [Prunus persica] Length = 870 Score = 139 bits (350), Expect = 1e-35 Identities = 63/72 (87%), Positives = 69/72 (95%) Frame = -1 Query: 390 GVCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRW 211 G+CPSRIDIVTGWGRRSRVTG+SLVRQ+V+ELLN+F FPFFTENGNSGCFVGCGEPL +W Sbjct: 799 GICPSRIDIVTGWGRRSRVTGSSLVRQAVEELLNMFSFPFFTENGNSGCFVGCGEPLNKW 858 Query: 210 LDQSYVERMHLL 175 L QSYVERMHLL Sbjct: 859 LLQSYVERMHLL 870 >ref|XP_018831595.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Juglans regia] ref|XP_018831596.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Juglans regia] ref|XP_018831597.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Juglans regia] ref|XP_018831598.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Juglans regia] ref|XP_018831599.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Juglans regia] Length = 882 Score = 139 bits (350), Expect = 1e-35 Identities = 65/72 (90%), Positives = 68/72 (94%) Frame = -1 Query: 390 GVCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRW 211 G+ PSRIDIVTGWGRRSRVTG+SLVRQ+VQELLNIF FPFFTENGNSGCFVGCGEPL RW Sbjct: 811 GIAPSRIDIVTGWGRRSRVTGSSLVRQAVQELLNIFSFPFFTENGNSGCFVGCGEPLNRW 870 Query: 210 LDQSYVERMHLL 175 L QSYVERMHLL Sbjct: 871 LLQSYVERMHLL 882 >gb|PKI78031.1| hypothetical protein CRG98_001651 [Punica granatum] Length = 491 Score = 137 bits (344), Expect = 1e-35 Identities = 62/72 (86%), Positives = 68/72 (94%) Frame = -1 Query: 390 GVCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRW 211 GV P+RIDIVTGWGRRSR+TG+SLVRQ+VQELLN+F FPFFTENGN+GCFVGCGEPL RW Sbjct: 420 GVSPTRIDIVTGWGRRSRITGSSLVRQAVQELLNLFSFPFFTENGNTGCFVGCGEPLNRW 479 Query: 210 LDQSYVERMHLL 175 L QSYVERMHLL Sbjct: 480 LHQSYVERMHLL 491 >ref|XP_017236253.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Daucus carota subsp. sativus] ref|XP_017236254.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Daucus carota subsp. sativus] gb|KZN04476.1| hypothetical protein DCAR_005313 [Daucus carota subsp. sativus] Length = 856 Score = 139 bits (349), Expect = 2e-35 Identities = 64/72 (88%), Positives = 68/72 (94%) Frame = -1 Query: 390 GVCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRW 211 G+CP RIDIVTGWGRRSRVTG+SLVRQSVQELLN+FQFPF+TENGNSGCFVGCGE L RW Sbjct: 785 GICPGRIDIVTGWGRRSRVTGSSLVRQSVQELLNMFQFPFYTENGNSGCFVGCGETLNRW 844 Query: 210 LDQSYVERMHLL 175 L QSYVERMHLL Sbjct: 845 LLQSYVERMHLL 856 >ref|XP_010112585.1| pentatricopeptide repeat-containing protein At1g74750 [Morus notabilis] gb|EXC34220.1| hypothetical protein L484_010090 [Morus notabilis] Length = 872 Score = 139 bits (349), Expect = 2e-35 Identities = 64/72 (88%), Positives = 67/72 (93%) Frame = -1 Query: 390 GVCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRW 211 G+CPSRIDIVTGWGRRSRVTG SLVRQ+VQELL +F FPFFTENGNSGCFVGCGEPL RW Sbjct: 801 GICPSRIDIVTGWGRRSRVTGASLVRQAVQELLRMFSFPFFTENGNSGCFVGCGEPLNRW 860 Query: 210 LDQSYVERMHLL 175 L QSYVERMHLL Sbjct: 861 LLQSYVERMHLL 872 >ref|XP_015879483.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like, partial [Ziziphus jujuba] Length = 281 Score = 132 bits (332), Expect = 2e-35 Identities = 61/72 (84%), Positives = 66/72 (91%) Frame = -1 Query: 390 GVCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRW 211 G+ PSRIDIVTGWGRRSR+TGTSLVRQ+VQ+LL +F FPFFTEN NSGCFVGCGEPL RW Sbjct: 210 GIGPSRIDIVTGWGRRSRITGTSLVRQAVQDLLQMFSFPFFTENSNSGCFVGCGEPLNRW 269 Query: 210 LDQSYVERMHLL 175 L QSYVERMHLL Sbjct: 270 LLQSYVERMHLL 281