BLASTX nr result
ID: Chrysanthemum21_contig00031133
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00031133 (384 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH99785.1| F-box domain, cyclin-like protein [Cynara cardunc... 89 4e-18 ref|XP_023768885.1| EIN3-binding F-box protein 1-like [Lactuca s... 87 3e-17 ref|XP_021987889.1| EIN3-binding F-box protein 1-like [Helianthu... 84 3e-16 gb|PHT57314.1| EIN3-binding F-box protein 2 [Capsicum baccatum] 63 8e-09 gb|PLY81619.1| hypothetical protein LSAT_1X43380 [Lactuca sativa] 63 8e-09 ref|XP_016561197.1| PREDICTED: EIN3-binding F-box protein 1-like... 62 1e-08 ref|XP_010048202.2| PREDICTED: EIN3-binding F-box protein 1 [Euc... 62 1e-08 ref|XP_006364926.1| PREDICTED: EIN3-binding F-box protein 1-like... 61 3e-08 gb|KCW80383.1| hypothetical protein EUGRSUZ_C01744 [Eucalyptus g... 61 4e-08 gb|PHT91525.1| EIN3-binding F-box protein 2 [Capsicum annuum] 61 4e-08 ref|XP_022867839.1| EIN3-binding F-box protein 1-like [Olea euro... 60 5e-08 gb|PHU27422.1| EIN3-binding F-box protein 2 [Capsicum chinense] 60 7e-08 gb|PNT33723.1| hypothetical protein POPTR_006G254100v3 [Populus ... 59 2e-07 ref|XP_011039690.1| PREDICTED: EIN3-binding F-box protein 1-like... 59 2e-07 ref|XP_002308665.2| grr1 family protein [Populus trichocarpa] 59 2e-07 ref|XP_016750364.1| PREDICTED: EIN3-binding F-box protein 1-like... 59 2e-07 ref|XP_017630667.1| PREDICTED: EIN3-binding F-box protein 1-like... 59 2e-07 ref|XP_012442351.1| PREDICTED: EIN3-binding F-box protein 1 isof... 59 2e-07 gb|PON34708.1| F-box domain containing protein [Parasponia ander... 58 3e-07 ref|XP_016689501.1| PREDICTED: EIN3-binding F-box protein 1-like... 58 3e-07 >gb|KVH99785.1| F-box domain, cyclin-like protein [Cynara cardunculus var. scolymus] Length = 683 Score = 89.4 bits (220), Expect = 4e-18 Identities = 43/52 (82%), Positives = 44/52 (84%) Frame = +1 Query: 223 MQNLFGEDVLYHGMSKYQDSEECNLFLSLGRSVDVYVPSRKRSRVTAPFVFC 378 MQ LFGEDVL HGM KYQ+SEE NLFLSLG VDVY P RKRSRVTAPFVFC Sbjct: 1 MQKLFGEDVLCHGMPKYQNSEESNLFLSLGHHVDVYFPPRKRSRVTAPFVFC 52 >ref|XP_023768885.1| EIN3-binding F-box protein 1-like [Lactuca sativa] Length = 634 Score = 86.7 bits (213), Expect = 3e-17 Identities = 42/54 (77%), Positives = 43/54 (79%) Frame = +1 Query: 223 MQNLFGEDVLYHGMSKYQDSEECNLFLSLGRSVDVYVPSRKRSRVTAPFVFCEQ 384 MQ FGEDVLYHGM KY SEE NLFLSLG VDVY P RKRSRV+APFVF EQ Sbjct: 1 MQKFFGEDVLYHGMPKYHASEESNLFLSLGHHVDVYFPPRKRSRVSAPFVFSEQ 54 >ref|XP_021987889.1| EIN3-binding F-box protein 1-like [Helianthus annuus] gb|OTG38547.1| putative F-box domain, Leucine-rich repeat domain, L domain-like protein [Helianthus annuus] Length = 625 Score = 84.0 bits (206), Expect = 3e-16 Identities = 40/53 (75%), Positives = 44/53 (83%) Frame = +1 Query: 223 MQNLFGEDVLYHGMSKYQDSEECNLFLSLGRSVDVYVPSRKRSRVTAPFVFCE 381 MQ L GEDVLYHGM KYQ EE ++FLSLG+ VDVY P+RKRSRVTAPFVF E Sbjct: 1 MQKLIGEDVLYHGMPKYQTLEESDIFLSLGQHVDVYFPTRKRSRVTAPFVFSE 53 >gb|PHT57314.1| EIN3-binding F-box protein 2 [Capsicum baccatum] Length = 669 Score = 62.8 bits (151), Expect = 8e-09 Identities = 28/52 (53%), Positives = 35/52 (67%) Frame = +1 Query: 229 NLFGEDVLYHGMSKYQDSEECNLFLSLGRSVDVYVPSRKRSRVTAPFVFCEQ 384 N G+D YHG Y +E NLF+SLG +DVY P KRSR+TAPF+F E+ Sbjct: 6 NFTGDDAFYHGGVVYPSPKESNLFMSLGHHMDVYFPPCKRSRITAPFIFTEK 57 >gb|PLY81619.1| hypothetical protein LSAT_1X43380 [Lactuca sativa] Length = 674 Score = 62.8 bits (151), Expect = 8e-09 Identities = 31/41 (75%), Positives = 32/41 (78%) Frame = +1 Query: 262 MSKYQDSEECNLFLSLGRSVDVYVPSRKRSRVTAPFVFCEQ 384 M KY SEE NLFLSLG VDVY P RKRSRV+APFVF EQ Sbjct: 1 MPKYHASEESNLFLSLGHHVDVYFPPRKRSRVSAPFVFSEQ 41 >ref|XP_016561197.1| PREDICTED: EIN3-binding F-box protein 1-like [Capsicum annuum] Length = 669 Score = 62.4 bits (150), Expect = 1e-08 Identities = 28/52 (53%), Positives = 35/52 (67%) Frame = +1 Query: 229 NLFGEDVLYHGMSKYQDSEECNLFLSLGRSVDVYVPSRKRSRVTAPFVFCEQ 384 N G+D YHG Y +E NLF+SLG +DVY P KRSR+TAPF+F E+ Sbjct: 6 NFTGDDAFYHGGVVYPSPKESNLFVSLGHHMDVYFPPCKRSRITAPFIFTEK 57 >ref|XP_010048202.2| PREDICTED: EIN3-binding F-box protein 1 [Eucalyptus grandis] Length = 770 Score = 62.4 bits (150), Expect = 1e-08 Identities = 39/82 (47%), Positives = 45/82 (54%), Gaps = 16/82 (19%) Frame = +1 Query: 184 FCS*SRVFSS----------------ILLMQNLFGEDVLYHGMSKYQDSEECNLFLSLGR 315 FCS SRVF S +++ GED Y G S YQ +E NLFLSLG Sbjct: 103 FCSLSRVFGSRPFRSPPPGVTGAVPMSKVLRFTGGED-FYSGRSIYQSPKEANLFLSLGN 161 Query: 316 SVDVYVPSRKRSRVTAPFVFCE 381 VDVY P KRSR++APFVF E Sbjct: 162 HVDVYFPPSKRSRISAPFVFSE 183 >ref|XP_006364926.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum] Length = 669 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/52 (55%), Positives = 34/52 (65%) Frame = +1 Query: 229 NLFGEDVLYHGMSKYQDSEECNLFLSLGRSVDVYVPSRKRSRVTAPFVFCEQ 384 N G+D YHG + Y +E +LFLSLG VDVY P KRSRV PFVF E+ Sbjct: 6 NFSGDDAFYHGGAVYPSPKESSLFLSLGNHVDVYFPPCKRSRVAVPFVFTEK 57 >gb|KCW80383.1| hypothetical protein EUGRSUZ_C01744 [Eucalyptus grandis] Length = 643 Score = 60.8 bits (146), Expect = 4e-08 Identities = 31/48 (64%), Positives = 34/48 (70%) Frame = +1 Query: 238 GEDVLYHGMSKYQDSEECNLFLSLGRSVDVYVPSRKRSRVTAPFVFCE 381 GED Y G S YQ +E NLFLSLG VDVY P KRSR++APFVF E Sbjct: 10 GED-FYSGRSIYQSPKEANLFLSLGNHVDVYFPPSKRSRISAPFVFSE 56 >gb|PHT91525.1| EIN3-binding F-box protein 2 [Capsicum annuum] Length = 670 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/49 (55%), Positives = 34/49 (69%) Frame = +1 Query: 238 GEDVLYHGMSKYQDSEECNLFLSLGRSVDVYVPSRKRSRVTAPFVFCEQ 384 G+D YHG Y +E NLF+SLG +DVY P KRSR+TAPF+F E+ Sbjct: 10 GDDAFYHGGVVYPSPKESNLFVSLGHHMDVYFPPCKRSRITAPFIFTEK 58 >ref|XP_022867839.1| EIN3-binding F-box protein 1-like [Olea europaea var. sylvestris] Length = 668 Score = 60.5 bits (145), Expect = 5e-08 Identities = 28/52 (53%), Positives = 38/52 (73%) Frame = +1 Query: 229 NLFGEDVLYHGMSKYQDSEECNLFLSLGRSVDVYVPSRKRSRVTAPFVFCEQ 384 N G+D L+ G + +S+E +L+LSLG VD+YVP RKRSRVTAPF+ C + Sbjct: 6 NFSGDDDLFPGGFLFPNSKEPSLYLSLGHHVDMYVPPRKRSRVTAPFIVCRE 57 >gb|PHU27422.1| EIN3-binding F-box protein 2 [Capsicum chinense] Length = 669 Score = 60.1 bits (144), Expect = 7e-08 Identities = 27/52 (51%), Positives = 34/52 (65%) Frame = +1 Query: 229 NLFGEDVLYHGMSKYQDSEECNLFLSLGRSVDVYVPSRKRSRVTAPFVFCEQ 384 N G+D YHG Y +E NLF+ LG +DVY P KRSR+TAPF+F E+ Sbjct: 6 NFTGDDAFYHGGVVYPSPKESNLFVFLGHHMDVYFPPCKRSRITAPFIFTEK 57 >gb|PNT33723.1| hypothetical protein POPTR_006G254100v3 [Populus trichocarpa] Length = 646 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = +1 Query: 238 GEDVLYHGMSKYQDSEECNLFLSLGRSVDVYVPSRKRSRVTAPFVFCEQ 384 GE+ G Y + +E NLFLS+GR VDVY PSRKRSR++APFVF E+ Sbjct: 9 GENDFCPGGPIYTNHKEQNLFLSIGRPVDVYFPSRKRSRISAPFVFTEE 57 >ref|XP_011039690.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica] Length = 646 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = +1 Query: 238 GEDVLYHGMSKYQDSEECNLFLSLGRSVDVYVPSRKRSRVTAPFVFCEQ 384 GE+ G Y + +E NLFLS+GR VDVY PSRKRSR++APFVF E+ Sbjct: 9 GENDFCPGGPIYTNHKEQNLFLSIGRPVDVYFPSRKRSRISAPFVFTEE 57 >ref|XP_002308665.2| grr1 family protein [Populus trichocarpa] Length = 646 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = +1 Query: 238 GEDVLYHGMSKYQDSEECNLFLSLGRSVDVYVPSRKRSRVTAPFVFCEQ 384 GE+ G Y + +E NLFLS+GR VDVY PSRKRSR++APFVF E+ Sbjct: 9 GENDFCPGGPIYTNHKEQNLFLSIGRPVDVYFPSRKRSRISAPFVFTEE 57 >ref|XP_016750364.1| PREDICTED: EIN3-binding F-box protein 1-like [Gossypium hirsutum] Length = 652 Score = 58.9 bits (141), Expect = 2e-07 Identities = 32/54 (59%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +1 Query: 223 MQNLF---GEDVLYHGMSKYQDSEECNLFLSLGRSVDVYVPSRKRSRVTAPFVF 375 M LF G D G S Y + +E +LFLSLGR VDVY PSRKRSR++APFVF Sbjct: 1 MSKLFSFSGTDDFCPGGSMYPNPKESSLFLSLGRHVDVYFPSRKRSRISAPFVF 54 >ref|XP_017630667.1| PREDICTED: EIN3-binding F-box protein 1-like [Gossypium arboreum] gb|KHG28503.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum] Length = 652 Score = 58.9 bits (141), Expect = 2e-07 Identities = 32/54 (59%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +1 Query: 223 MQNLF---GEDVLYHGMSKYQDSEECNLFLSLGRSVDVYVPSRKRSRVTAPFVF 375 M LF G D G S Y + +E +LFLSLGR VDVY PSRKRSR++APFVF Sbjct: 1 MSKLFSFSGTDDFCPGGSMYPNPKESSLFLSLGRHVDVYFPSRKRSRISAPFVF 54 >ref|XP_012442351.1| PREDICTED: EIN3-binding F-box protein 1 isoform X2 [Gossypium raimondii] Length = 699 Score = 58.9 bits (141), Expect = 2e-07 Identities = 30/48 (62%), Positives = 35/48 (72%) Frame = +1 Query: 232 LFGEDVLYHGMSKYQDSEECNLFLSLGRSVDVYVPSRKRSRVTAPFVF 375 L G D G S Y + +E +LFLSLGR VDVY PSRKRSR++APFVF Sbjct: 54 LVGTDDFCPGGSIYTNPKESSLFLSLGRHVDVYFPSRKRSRISAPFVF 101 >gb|PON34708.1| F-box domain containing protein [Parasponia andersonii] Length = 648 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/49 (59%), Positives = 35/49 (71%) Frame = +1 Query: 238 GEDVLYHGMSKYQDSEECNLFLSLGRSVDVYVPSRKRSRVTAPFVFCEQ 384 G D G S Y + +E +LFLSLG VDVY PSRKRSR++APFVF E+ Sbjct: 9 GNDDFCPGGSIYSNPKEPSLFLSLGNHVDVYFPSRKRSRISAPFVFIEE 57 >ref|XP_016689501.1| PREDICTED: EIN3-binding F-box protein 1-like [Gossypium hirsutum] Length = 652 Score = 58.2 bits (139), Expect = 3e-07 Identities = 32/54 (59%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +1 Query: 223 MQNLF---GEDVLYHGMSKYQDSEECNLFLSLGRSVDVYVPSRKRSRVTAPFVF 375 M LF G D G S Y + +E +LFLSLGR VDVY PSRKRSR++APFVF Sbjct: 1 MSKLFSFSGTDDFCPGGSIYTNPKESSLFLSLGRHVDVYFPSRKRSRISAPFVF 54