BLASTX nr result
ID: Chrysanthemum21_contig00030929
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00030929 (402 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022001038.1| uncharacterized protein LOC110898554 [Helian... 62 1e-08 ref|XP_021886996.1| E3 ubiquitin-protein ligase KEG [Carica papa... 61 3e-08 gb|KZV47630.1| hypothetical protein F511_14416 [Dorcoceras hygro... 59 2e-07 ref|XP_020874339.1| E3 ubiquitin-protein ligase KEG [Arabidopsis... 59 3e-07 ref|XP_020265600.1| E3 ubiquitin-protein ligase KEG [Asparagus o... 58 4e-07 ref|XP_022863813.1| E3 ubiquitin-protein ligase KEG-like isoform... 58 4e-07 ref|XP_022863812.1| E3 ubiquitin-protein ligase KEG-like isoform... 58 4e-07 gb|KVH90263.1| Protein kinase, catalytic domain-containing prote... 58 4e-07 ref|XP_022863811.1| E3 ubiquitin-protein ligase KEG-like isoform... 58 4e-07 ref|XP_022863810.1| E3 ubiquitin-protein ligase KEG-like isoform... 58 4e-07 ref|XP_002308671.2| hypothetical protein POPTR_0006s27180g [Popu... 58 4e-07 gb|OAY53659.1| hypothetical protein MANES_03G013800 [Manihot esc... 58 5e-07 ref|XP_018812879.1| PREDICTED: E3 ubiquitin-protein ligase KEG-l... 58 5e-07 ref|XP_011039666.1| PREDICTED: E3 ubiquitin-protein ligase KEG [... 58 5e-07 ref|XP_021608020.1| E3 ubiquitin-protein ligase KEG-like [Maniho... 58 5e-07 gb|KCW45330.1| hypothetical protein EUGRSUZ_L01004, partial [Euc... 57 7e-07 ref|XP_010040283.1| PREDICTED: E3 ubiquitin-protein ligase KEG [... 57 7e-07 ref|XP_007137007.1| hypothetical protein PHAVU_009G092300g [Phas... 57 7e-07 gb|PIN09859.1| MEKK [Handroanthus impetiginosus] 57 7e-07 ref|XP_012076533.1| E3 ubiquitin-protein ligase KEG [Jatropha cu... 57 7e-07 >ref|XP_022001038.1| uncharacterized protein LOC110898554 [Helianthus annuus] gb|OTG01529.1| putative protein kinase superfamily protein [Helianthus annuus] Length = 626 Score = 62.4 bits (150), Expect = 1e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 307 ICIIMKFYEGSVGDQMARLKEGKFSLGDVLRY 402 ICIIMKFYE S+GD+MARLKEGKFS GDVLRY Sbjct: 121 ICIIMKFYEASIGDRMARLKEGKFSFGDVLRY 152 >ref|XP_021886996.1| E3 ubiquitin-protein ligase KEG [Carica papaya] ref|XP_021886997.1| E3 ubiquitin-protein ligase KEG [Carica papaya] ref|XP_021886998.1| E3 ubiquitin-protein ligase KEG [Carica papaya] ref|XP_021886999.1| E3 ubiquitin-protein ligase KEG [Carica papaya] ref|XP_021887000.1| E3 ubiquitin-protein ligase KEG [Carica papaya] ref|XP_021887001.1| E3 ubiquitin-protein ligase KEG [Carica papaya] ref|XP_021887002.1| E3 ubiquitin-protein ligase KEG [Carica papaya] Length = 627 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 307 ICIIMKFYEGSVGDQMARLKEGKFSLGDVLRY 402 ICIIMKFYEGSVGD+MARLKEGK SL DVLRY Sbjct: 123 ICIIMKFYEGSVGDKMARLKEGKLSLPDVLRY 154 >gb|KZV47630.1| hypothetical protein F511_14416 [Dorcoceras hygrometricum] Length = 622 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 307 ICIIMKFYEGSVGDQMARLKEGKFSLGDVLRY 402 ICI+MKFYEGSVGD+MARLK GK SL DVLRY Sbjct: 122 ICIVMKFYEGSVGDKMARLKGGKLSLSDVLRY 153 >ref|XP_020874339.1| E3 ubiquitin-protein ligase KEG [Arabidopsis lyrata subsp. lyrata] ref|XP_020874340.1| E3 ubiquitin-protein ligase KEG [Arabidopsis lyrata subsp. lyrata] gb|EFH43511.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] Length = 612 Score = 58.5 bits (140), Expect = 3e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +1 Query: 307 ICIIMKFYEGSVGDQMARLKEGKFSLGDVLRY 402 ICIIMKFYEGSVGD+MARLK GK SL DVLRY Sbjct: 117 ICIIMKFYEGSVGDKMARLKGGKLSLPDVLRY 148 >ref|XP_020265600.1| E3 ubiquitin-protein ligase KEG [Asparagus officinalis] ref|XP_020265601.1| E3 ubiquitin-protein ligase KEG [Asparagus officinalis] ref|XP_020265602.1| E3 ubiquitin-protein ligase KEG [Asparagus officinalis] gb|ONK70340.1| uncharacterized protein A4U43_C05F32720 [Asparagus officinalis] Length = 617 Score = 58.2 bits (139), Expect = 4e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 307 ICIIMKFYEGSVGDQMARLKEGKFSLGDVLRY 402 +CI+MKFYEGSVGD+MARLK GK SL DVLRY Sbjct: 123 LCIVMKFYEGSVGDKMARLKGGKLSLSDVLRY 154 >ref|XP_022863813.1| E3 ubiquitin-protein ligase KEG-like isoform X4 [Olea europaea var. sylvestris] Length = 618 Score = 58.2 bits (139), Expect = 4e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 307 ICIIMKFYEGSVGDQMARLKEGKFSLGDVLRY 402 ICI+MKFYEGSVGD+MARLK GK S+ DVLRY Sbjct: 120 ICIVMKFYEGSVGDKMARLKGGKLSMSDVLRY 151 >ref|XP_022863812.1| E3 ubiquitin-protein ligase KEG-like isoform X3 [Olea europaea var. sylvestris] Length = 618 Score = 58.2 bits (139), Expect = 4e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 307 ICIIMKFYEGSVGDQMARLKEGKFSLGDVLRY 402 ICI+MKFYEGSVGD+MARLK GK S+ DVLRY Sbjct: 120 ICIVMKFYEGSVGDKMARLKGGKLSMSDVLRY 151 >gb|KVH90263.1| Protein kinase, catalytic domain-containing protein [Cynara cardunculus var. scolymus] Length = 624 Score = 58.2 bits (139), Expect = 4e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +1 Query: 307 ICIIMKFYEGSVGDQMARLKEGKFSLGDVLRY 402 ICI+MKFYEGSVGDQMAR K GK SL DVLRY Sbjct: 123 ICIVMKFYEGSVGDQMARFKGGKLSLPDVLRY 154 >ref|XP_022863811.1| E3 ubiquitin-protein ligase KEG-like isoform X2 [Olea europaea var. sylvestris] Length = 626 Score = 58.2 bits (139), Expect = 4e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 307 ICIIMKFYEGSVGDQMARLKEGKFSLGDVLRY 402 ICI+MKFYEGSVGD+MARLK GK S+ DVLRY Sbjct: 128 ICIVMKFYEGSVGDKMARLKGGKLSMSDVLRY 159 >ref|XP_022863810.1| E3 ubiquitin-protein ligase KEG-like isoform X1 [Olea europaea var. sylvestris] Length = 626 Score = 58.2 bits (139), Expect = 4e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 307 ICIIMKFYEGSVGDQMARLKEGKFSLGDVLRY 402 ICI+MKFYEGSVGD+MARLK GK S+ DVLRY Sbjct: 128 ICIVMKFYEGSVGDKMARLKGGKLSMSDVLRY 159 >ref|XP_002308671.2| hypothetical protein POPTR_0006s27180g [Populus trichocarpa] ref|XP_006382078.1| hypothetical protein POPTR_0006s27180g [Populus trichocarpa] ref|XP_006382079.1| hypothetical protein POPTR_0006s27180g [Populus trichocarpa] gb|PNT33753.1| hypothetical protein POPTR_006G255700v3 [Populus trichocarpa] gb|PNT33754.1| hypothetical protein POPTR_006G255700v3 [Populus trichocarpa] gb|PNT33755.1| hypothetical protein POPTR_006G255700v3 [Populus trichocarpa] gb|PNT33756.1| hypothetical protein POPTR_006G255700v3 [Populus trichocarpa] Length = 626 Score = 58.2 bits (139), Expect = 4e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 307 ICIIMKFYEGSVGDQMARLKEGKFSLGDVLRY 402 ICI+MKFYEGSVGD+MARLK GK SL DVLRY Sbjct: 122 ICIVMKFYEGSVGDKMARLKGGKLSLPDVLRY 153 >gb|OAY53659.1| hypothetical protein MANES_03G013800 [Manihot esculenta] Length = 565 Score = 57.8 bits (138), Expect = 5e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 307 ICIIMKFYEGSVGDQMARLKEGKFSLGDVLRY 402 ICI+MKFYEGS+GD+MAR+K GK SL DVLRY Sbjct: 57 ICIVMKFYEGSIGDKMARIKGGKLSLADVLRY 88 >ref|XP_018812879.1| PREDICTED: E3 ubiquitin-protein ligase KEG-like [Juglans regia] ref|XP_018812880.1| PREDICTED: E3 ubiquitin-protein ligase KEG-like [Juglans regia] ref|XP_018812881.1| PREDICTED: E3 ubiquitin-protein ligase KEG-like [Juglans regia] Length = 620 Score = 57.8 bits (138), Expect = 5e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 307 ICIIMKFYEGSVGDQMARLKEGKFSLGDVLRY 402 ICIIMKFYEGSVGD+MARL+EGK L DVLRY Sbjct: 122 ICIIMKFYEGSVGDKMARLREGKLLLTDVLRY 153 >ref|XP_011039666.1| PREDICTED: E3 ubiquitin-protein ligase KEG [Populus euphratica] ref|XP_011039667.1| PREDICTED: E3 ubiquitin-protein ligase KEG [Populus euphratica] ref|XP_011039668.1| PREDICTED: E3 ubiquitin-protein ligase KEG [Populus euphratica] ref|XP_011039669.1| PREDICTED: E3 ubiquitin-protein ligase KEG [Populus euphratica] Length = 626 Score = 57.8 bits (138), Expect = 5e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 307 ICIIMKFYEGSVGDQMARLKEGKFSLGDVLRY 402 ICI+MKFYEGS+GD+MARLK GK SL DVLRY Sbjct: 122 ICIVMKFYEGSIGDKMARLKGGKLSLPDVLRY 153 >ref|XP_021608020.1| E3 ubiquitin-protein ligase KEG-like [Manihot esculenta] ref|XP_021608021.1| E3 ubiquitin-protein ligase KEG-like [Manihot esculenta] gb|OAY53658.1| hypothetical protein MANES_03G013800 [Manihot esculenta] gb|OAY53660.1| hypothetical protein MANES_03G013800 [Manihot esculenta] Length = 631 Score = 57.8 bits (138), Expect = 5e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 307 ICIIMKFYEGSVGDQMARLKEGKFSLGDVLRY 402 ICI+MKFYEGS+GD+MAR+K GK SL DVLRY Sbjct: 123 ICIVMKFYEGSIGDKMARIKGGKLSLADVLRY 154 >gb|KCW45330.1| hypothetical protein EUGRSUZ_L01004, partial [Eucalyptus grandis] Length = 445 Score = 57.4 bits (137), Expect = 7e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 307 ICIIMKFYEGSVGDQMARLKEGKFSLGDVLRY 402 ICIIMKFYEGSVGD+MARLK GK SL +VLRY Sbjct: 127 ICIIMKFYEGSVGDKMARLKAGKLSLPEVLRY 158 >ref|XP_010040283.1| PREDICTED: E3 ubiquitin-protein ligase KEG [Eucalyptus grandis] Length = 475 Score = 57.4 bits (137), Expect = 7e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 307 ICIIMKFYEGSVGDQMARLKEGKFSLGDVLRY 402 ICIIMKFYEGSVGD+MARLK GK SL +VLRY Sbjct: 127 ICIIMKFYEGSVGDKMARLKAGKLSLPEVLRY 158 >ref|XP_007137007.1| hypothetical protein PHAVU_009G092300g [Phaseolus vulgaris] ref|XP_007137008.1| hypothetical protein PHAVU_009G092300g [Phaseolus vulgaris] gb|ESW09001.1| hypothetical protein PHAVU_009G092300g [Phaseolus vulgaris] gb|ESW09002.1| hypothetical protein PHAVU_009G092300g [Phaseolus vulgaris] Length = 620 Score = 57.4 bits (137), Expect = 7e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 307 ICIIMKFYEGSVGDQMARLKEGKFSLGDVLRY 402 ICIIM FYEGSVGD+MARL+EG+ SL DVLRY Sbjct: 121 ICIIMNFYEGSVGDKMARLREGRISLDDVLRY 152 >gb|PIN09859.1| MEKK [Handroanthus impetiginosus] Length = 623 Score = 57.4 bits (137), Expect = 7e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 307 ICIIMKFYEGSVGDQMARLKEGKFSLGDVLRY 402 ICI+MKFYEGSVGD+MAR K GK SL DVLRY Sbjct: 123 ICIVMKFYEGSVGDKMARFKGGKLSLNDVLRY 154 >ref|XP_012076533.1| E3 ubiquitin-protein ligase KEG [Jatropha curcas] ref|XP_012076534.1| E3 ubiquitin-protein ligase KEG [Jatropha curcas] gb|KDP33580.1| hypothetical protein JCGZ_07151 [Jatropha curcas] Length = 628 Score = 57.4 bits (137), Expect = 7e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 307 ICIIMKFYEGSVGDQMARLKEGKFSLGDVLRY 402 ICIIMKFYEGS+GD++ARLK GK SL DVLRY Sbjct: 123 ICIIMKFYEGSIGDKIARLKGGKLSLADVLRY 154