BLASTX nr result
ID: Chrysanthemum21_contig00030879
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00030879 (525 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH92880.1| DNA/RNA helicase, DEAD/DEAH box type, N-terminal ... 88 6e-17 >gb|KVH92880.1| DNA/RNA helicase, DEAD/DEAH box type, N-terminal [Cynara cardunculus var. scolymus] Length = 715 Score = 87.8 bits (216), Expect = 6e-17 Identities = 41/56 (73%), Positives = 47/56 (83%) Frame = -2 Query: 440 LKCFMHMLLCLSLRKFQQLSDSCLLFHLYFFLQVRYLLQGGAKCRTLCHPTILVWG 273 L+C++H+ LSL KF Q+SDSCLLFHLYFF QVRYLLQGGAKCRTLCHP +L G Sbjct: 237 LQCYVHV--ALSLLKFHQVSDSCLLFHLYFFSQVRYLLQGGAKCRTLCHPLVLQAG 290