BLASTX nr result
ID: Chrysanthemum21_contig00030833
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00030833 (884 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH91571.1| Aminoacyl-tRNA synthetase, class 1a, anticodon-bi... 60 2e-06 >gb|KVH91571.1| Aminoacyl-tRNA synthetase, class 1a, anticodon-binding [Cynara cardunculus var. scolymus] Length = 1080 Score = 60.1 bits (144), Expect = 2e-06 Identities = 32/52 (61%), Positives = 39/52 (75%) Frame = +1 Query: 691 CVIMFIVFTNLIIQKAVQVLSLRNCSLFTKSSSFSIIDFLRCSSIELSSLFH 846 C I + + ++ K VQVLS R+CS FTKSS FSIIDF RCSS++LSSLFH Sbjct: 2 CTINWSGISLILSYKTVQVLSFRSCSSFTKSS-FSIIDFRRCSSMDLSSLFH 52