BLASTX nr result
ID: Chrysanthemum21_contig00030677
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00030677 (489 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI10491.1| hypothetical protein Ccrd_011090, partial [Cynara... 60 3e-07 ref|XP_021992897.1| WD repeat-containing protein 44 [Helianthus ... 55 8e-06 >gb|KVI10491.1| hypothetical protein Ccrd_011090, partial [Cynara cardunculus var. scolymus] Length = 981 Score = 59.7 bits (143), Expect = 3e-07 Identities = 32/44 (72%), Positives = 35/44 (79%) Frame = -1 Query: 489 SSATNGYSFDRMSATWPEEKLVSAAAKNRSCRTSVALLD*MSPG 358 SSA+NGY FDR+SATWPEEKLV A KNRS RTSV + MSPG Sbjct: 910 SSASNGYFFDRISATWPEEKLV-LATKNRSPRTSVDYTNGMSPG 952 >ref|XP_021992897.1| WD repeat-containing protein 44 [Helianthus annuus] gb|OTG07259.1| putative transducin/WD40 repeat-like superfamily protein [Helianthus annuus] Length = 896 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = -1 Query: 489 SSATNGYSFDRMSATWPEEKLVSAAAKNRSCRTSVALLD*MSPG 358 SSATNGY FDR+SAT+PEEKLV + KNRS RTSV + ++ G Sbjct: 824 SSATNGYFFDRISATFPEEKLVMGSTKNRSPRTSVDFSNGLNAG 867