BLASTX nr result
ID: Chrysanthemum21_contig00030580
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00030580 (489 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023729766.1| zinc transporter ZTP29 [Lactuca sativa] 79 1e-14 gb|KVH90832.1| Zinc/iron permease [Cynara cardunculus var. scoly... 78 3e-14 ref|XP_022026412.1| zinc transporter ZTP29-like [Helianthus annu... 78 8e-14 ref|XP_021862926.1| zinc transporter ZTP29 [Spinacia oleracea] >... 76 1e-13 ref|XP_012828587.1| PREDICTED: zinc transporter ZTP29-like [Eryt... 76 1e-13 ref|XP_012829727.1| PREDICTED: zinc transporter ZTP29 [Erythrant... 75 3e-13 gb|PIM99855.1| hypothetical protein CDL12_27648 [Handroanthus im... 74 4e-13 ref|XP_012434421.1| PREDICTED: zinc transporter ZTP29-like isofo... 70 6e-13 ref|XP_012434418.1| PREDICTED: zinc transporter ZTP29-like isofo... 70 7e-13 gb|KJB21885.1| hypothetical protein B456_004G018900 [Gossypium r... 73 7e-13 ref|XP_022879038.1| zinc transporter ZTP29 isoform X3 [Olea euro... 74 7e-13 ref|XP_006446090.1| zinc transporter ZTP29 [Citrus clementina] >... 74 7e-13 ref|XP_021728952.1| zinc transporter ZTP29 [Chenopodium quinoa] 74 8e-13 ref|XP_021772043.1| zinc transporter ZTP29-like [Chenopodium qui... 74 8e-13 gb|EXB93278.1| hypothetical protein L484_015264 [Morus notabilis] 70 9e-13 gb|KZV55931.1| hypothetical protein F511_20753 [Dorcoceras hygro... 74 1e-12 ref|XP_021894098.1| LOW QUALITY PROTEIN: zinc transporter ZTP29 ... 73 1e-12 ref|XP_017227601.1| PREDICTED: zinc transporter ZTP29 [Daucus ca... 74 1e-12 gb|KHG12925.1| Zinc transporter ZTP29 -like protein [Gossypium a... 73 2e-12 gb|PPS05437.1| hypothetical protein GOBAR_AA15227 [Gossypium bar... 73 2e-12 >ref|XP_023729766.1| zinc transporter ZTP29 [Lactuca sativa] Length = 276 Score = 79.0 bits (193), Expect = 1e-14 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +3 Query: 3 PLAFDYAGQKHAVKAVFFGMAFMSASLYFLEISLPADIGL 122 PLAFDYAGQK AVKAVFFGMAFMSASLYFLEISLPAD+GL Sbjct: 237 PLAFDYAGQKQAVKAVFFGMAFMSASLYFLEISLPADVGL 276 >gb|KVH90832.1| Zinc/iron permease [Cynara cardunculus var. scolymus] Length = 295 Score = 78.2 bits (191), Expect = 3e-14 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +3 Query: 3 PLAFDYAGQKHAVKAVFFGMAFMSASLYFLEISLPADIGL 122 PLAFDYAGQK AVKAVFFGMAFMSASLYFLEISLPAD+GL Sbjct: 256 PLAFDYAGQKQAVKAVFFGMAFMSASLYFLEISLPADMGL 295 >ref|XP_022026412.1| zinc transporter ZTP29-like [Helianthus annuus] gb|OTG35390.1| putative zinc/iron permease [Helianthus annuus] Length = 347 Score = 77.8 bits (190), Expect = 8e-14 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +3 Query: 3 PLAFDYAGQKHAVKAVFFGMAFMSASLYFLEISLPADIGL 122 PLAFDYAGQK AVKAVFFGMAFMSASLYFLEISLP+D+GL Sbjct: 308 PLAFDYAGQKQAVKAVFFGMAFMSASLYFLEISLPSDVGL 347 >ref|XP_021862926.1| zinc transporter ZTP29 [Spinacia oleracea] gb|KNA05963.1| hypothetical protein SOVF_185520 [Spinacia oleracea] Length = 277 Score = 76.3 bits (186), Expect = 1e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +3 Query: 3 PLAFDYAGQKHAVKAVFFGMAFMSASLYFLEISLPADIGL 122 PLAFDYAGQK AVKAVFFGMAFMSASLYFLEISLPAD+ L Sbjct: 238 PLAFDYAGQKQAVKAVFFGMAFMSASLYFLEISLPADLSL 277 >ref|XP_012828587.1| PREDICTED: zinc transporter ZTP29-like [Erythranthe guttata] gb|EYU43829.1| hypothetical protein MIMGU_mgv1a011561mg [Erythranthe guttata] Length = 277 Score = 76.3 bits (186), Expect = 1e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +3 Query: 3 PLAFDYAGQKHAVKAVFFGMAFMSASLYFLEISLPADIGL 122 PLAFDYAGQK AVKAVFFGMAFMSASLYFLEISLPAD+ L Sbjct: 238 PLAFDYAGQKQAVKAVFFGMAFMSASLYFLEISLPADLSL 277 >ref|XP_012829727.1| PREDICTED: zinc transporter ZTP29 [Erythranthe guttata] gb|EYU46276.1| hypothetical protein MIMGU_mgv1a011508mg [Erythranthe guttata] Length = 279 Score = 75.5 bits (184), Expect = 3e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +3 Query: 3 PLAFDYAGQKHAVKAVFFGMAFMSASLYFLEISLPADIGL 122 PLAFDYAGQK AVKAVFFGMAFMSASLYFLEISLPA+I L Sbjct: 240 PLAFDYAGQKQAVKAVFFGMAFMSASLYFLEISLPAEISL 279 >gb|PIM99855.1| hypothetical protein CDL12_27648 [Handroanthus impetiginosus] Length = 229 Score = 74.3 bits (181), Expect = 4e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +3 Query: 3 PLAFDYAGQKHAVKAVFFGMAFMSASLYFLEISLPADIGL 122 PLAFDYAGQK AVKAVFFGMAFMSASLYFLEISLPA++ L Sbjct: 190 PLAFDYAGQKQAVKAVFFGMAFMSASLYFLEISLPAEMSL 229 >ref|XP_012434421.1| PREDICTED: zinc transporter ZTP29-like isoform X2 [Gossypium raimondii] gb|KJB45615.1| hypothetical protein B456_007G316100 [Gossypium raimondii] gb|KJB45617.1| hypothetical protein B456_007G316100 [Gossypium raimondii] Length = 90 Score = 70.5 bits (171), Expect = 6e-13 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = +3 Query: 3 PLAFDYAGQKHAVKAVFFGMAFMSASLYFLEISLPADIGL 122 PL FDY+GQK AVKAVFFGMAFMSASLYFLE+SLP D+ L Sbjct: 51 PLVFDYSGQKQAVKAVFFGMAFMSASLYFLELSLPKDMSL 90 >ref|XP_012434418.1| PREDICTED: zinc transporter ZTP29-like isoform X1 [Gossypium raimondii] ref|XP_012434419.1| PREDICTED: zinc transporter ZTP29-like isoform X1 [Gossypium raimondii] ref|XP_012434420.1| PREDICTED: zinc transporter ZTP29-like isoform X1 [Gossypium raimondii] gb|KJB45616.1| hypothetical protein B456_007G316100 [Gossypium raimondii] Length = 97 Score = 70.5 bits (171), Expect = 7e-13 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = +3 Query: 3 PLAFDYAGQKHAVKAVFFGMAFMSASLYFLEISLPADIGL 122 PL FDY+GQK AVKAVFFGMAFMSASLYFLE+SLP D+ L Sbjct: 58 PLVFDYSGQKQAVKAVFFGMAFMSASLYFLELSLPKDMSL 97 >gb|KJB21885.1| hypothetical protein B456_004G018900 [Gossypium raimondii] Length = 206 Score = 73.2 bits (178), Expect = 7e-13 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +3 Query: 3 PLAFDYAGQKHAVKAVFFGMAFMSASLYFLEISLPADIGL 122 PLAFDYAGQK AVKAVFFGMAFMSASLYFLE+SLP D+ L Sbjct: 167 PLAFDYAGQKQAVKAVFFGMAFMSASLYFLELSLPKDMSL 206 >ref|XP_022879038.1| zinc transporter ZTP29 isoform X3 [Olea europaea var. sylvestris] Length = 276 Score = 74.3 bits (181), Expect = 7e-13 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +3 Query: 3 PLAFDYAGQKHAVKAVFFGMAFMSASLYFLEISLPADIGL 122 PLAFDYAGQK AVKAVFFGMAFMSASLYFLEISLP D+ L Sbjct: 237 PLAFDYAGQKQAVKAVFFGMAFMSASLYFLEISLPEDLSL 276 >ref|XP_006446090.1| zinc transporter ZTP29 [Citrus clementina] ref|XP_024047272.1| zinc transporter ZTP29 [Citrus clementina] gb|ESR59330.1| hypothetical protein CICLE_v10016213mg [Citrus clementina] gb|ESR59331.1| hypothetical protein CICLE_v10016213mg [Citrus clementina] Length = 276 Score = 74.3 bits (181), Expect = 7e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +3 Query: 3 PLAFDYAGQKHAVKAVFFGMAFMSASLYFLEISLPADIGL 122 PLAFDYAGQK AVKAVFFGMAFMSASLYFLEISLPA++ L Sbjct: 237 PLAFDYAGQKQAVKAVFFGMAFMSASLYFLEISLPAEMSL 276 >ref|XP_021728952.1| zinc transporter ZTP29 [Chenopodium quinoa] Length = 277 Score = 74.3 bits (181), Expect = 8e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +3 Query: 3 PLAFDYAGQKHAVKAVFFGMAFMSASLYFLEISLPADIGL 122 PLAFDYAGQK AVKAVFFGMAFMSASLYFLEISLPA++ L Sbjct: 238 PLAFDYAGQKQAVKAVFFGMAFMSASLYFLEISLPAEMSL 277 >ref|XP_021772043.1| zinc transporter ZTP29-like [Chenopodium quinoa] Length = 277 Score = 74.3 bits (181), Expect = 8e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +3 Query: 3 PLAFDYAGQKHAVKAVFFGMAFMSASLYFLEISLPADIGL 122 PLAFDYAGQK AVKAVFFGMAFMSASLYFLEISLPA++ L Sbjct: 238 PLAFDYAGQKQAVKAVFFGMAFMSASLYFLEISLPAEMSL 277 >gb|EXB93278.1| hypothetical protein L484_015264 [Morus notabilis] Length = 80 Score = 69.7 bits (169), Expect = 9e-13 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = +3 Query: 3 PLAFDYAGQKHAVKAVFFGMAFMSASLYFLEISLPADIGL 122 PLAFDYAGQK A+KAVF GMAFMSASLYFLEISLP ++ L Sbjct: 41 PLAFDYAGQKQAIKAVFLGMAFMSASLYFLEISLPEEMSL 80 >gb|KZV55931.1| hypothetical protein F511_20753 [Dorcoceras hygrometricum] Length = 279 Score = 73.9 bits (180), Expect = 1e-12 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +3 Query: 3 PLAFDYAGQKHAVKAVFFGMAFMSASLYFLEISLPADIGL 122 PLAFDYAGQK AVKAVFFGMAFMS SLYFLE+SLPAD+ L Sbjct: 240 PLAFDYAGQKQAVKAVFFGMAFMSVSLYFLEVSLPADMSL 279 >ref|XP_021894098.1| LOW QUALITY PROTEIN: zinc transporter ZTP29 [Carica papaya] Length = 231 Score = 73.2 bits (178), Expect = 1e-12 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +3 Query: 3 PLAFDYAGQKHAVKAVFFGMAFMSASLYFLEISLPADIGL 122 PLAFDYAGQK AVKAVFFGMAFMSASLYFLEISLP D+ + Sbjct: 192 PLAFDYAGQKQAVKAVFFGMAFMSASLYFLEISLPEDMSM 231 >ref|XP_017227601.1| PREDICTED: zinc transporter ZTP29 [Daucus carota subsp. sativus] gb|KZM80887.1| hypothetical protein DCAR_031567 [Daucus carota subsp. sativus] Length = 275 Score = 73.6 bits (179), Expect = 1e-12 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +3 Query: 3 PLAFDYAGQKHAVKAVFFGMAFMSASLYFLEISLPADIGL 122 PLAFDYAGQK AVKAVFFGMAFMSASLYFLE+SLPA++ L Sbjct: 236 PLAFDYAGQKQAVKAVFFGMAFMSASLYFLELSLPAEMSL 275 >gb|KHG12925.1| Zinc transporter ZTP29 -like protein [Gossypium arboreum] Length = 259 Score = 73.2 bits (178), Expect = 2e-12 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +3 Query: 3 PLAFDYAGQKHAVKAVFFGMAFMSASLYFLEISLPADIGL 122 PLAFDYAGQK AVKAVFFGMAFMSASLYFLE+SLP D+ L Sbjct: 220 PLAFDYAGQKQAVKAVFFGMAFMSASLYFLELSLPKDMSL 259 >gb|PPS05437.1| hypothetical protein GOBAR_AA15227 [Gossypium barbadense] Length = 276 Score = 73.2 bits (178), Expect = 2e-12 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +3 Query: 3 PLAFDYAGQKHAVKAVFFGMAFMSASLYFLEISLPADIGL 122 PLAFDYAGQK AVKAVFFGMAFMSASLYFLE+SLP D+ L Sbjct: 237 PLAFDYAGQKQAVKAVFFGMAFMSASLYFLELSLPKDMSL 276