BLASTX nr result
ID: Chrysanthemum21_contig00030553
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00030553 (506 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI03802.1| Peptidase C13, legumain [Cynara cardunculus var. ... 84 1e-15 ref|XP_023755050.1| putative GPI-anchor transamidase [Lactuca sa... 77 2e-13 ref|XP_021976077.1| putative GPI-anchor transamidase [Helianthus... 76 4e-13 gb|OTG37099.1| putative peptidase C13 family [Helianthus annuus] 73 5e-12 >gb|KVI03802.1| Peptidase C13, legumain [Cynara cardunculus var. scolymus] Length = 417 Score = 83.6 bits (205), Expect = 1e-15 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = -2 Query: 496 KVVERGTCPHAELWDVIVEKVQSIKDVDSIVNYGLVGMLALVAVSTWQSS 347 + V+ GTCPHA+LW++IVEKVQ IKDVDSIVNYG VG+L LVAVSTW SS Sbjct: 368 QAVKSGTCPHADLWNMIVEKVQRIKDVDSIVNYGFVGLLTLVAVSTWHSS 417 >ref|XP_023755050.1| putative GPI-anchor transamidase [Lactuca sativa] gb|PLY92070.1| hypothetical protein LSAT_5X179521 [Lactuca sativa] Length = 413 Score = 77.0 bits (188), Expect = 2e-13 Identities = 32/45 (71%), Positives = 43/45 (95%) Frame = -2 Query: 481 GTCPHAELWDVIVEKVQSIKDVDSIVNYGLVGMLALVAVSTWQSS 347 G+CPHAELWD++V+K+Q+ K+VD+IVNYGL+G+L LVA+STWQSS Sbjct: 363 GSCPHAELWDMMVDKLQTFKNVDTIVNYGLLGLLTLVALSTWQSS 407 >ref|XP_021976077.1| putative GPI-anchor transamidase [Helianthus annuus] Length = 400 Score = 76.3 bits (186), Expect = 4e-13 Identities = 36/50 (72%), Positives = 41/50 (82%) Frame = -2 Query: 496 KVVERGTCPHAELWDVIVEKVQSIKDVDSIVNYGLVGMLALVAVSTWQSS 347 K+V+ G CPHA+ W+ IVEK Q IK+ D IVNYGLVGML LVAVSTWQSS Sbjct: 351 KLVKGGGCPHADWWNAIVEKFQGIKNGDMIVNYGLVGMLTLVAVSTWQSS 400 >gb|OTG37099.1| putative peptidase C13 family [Helianthus annuus] Length = 398 Score = 73.2 bits (178), Expect = 5e-12 Identities = 34/48 (70%), Positives = 39/48 (81%) Frame = -2 Query: 496 KVVERGTCPHAELWDVIVEKVQSIKDVDSIVNYGLVGMLALVAVSTWQ 353 K+V+ G CPHA+ W+ IVEK Q IK+ D IVNYGLVGML LVAVSTWQ Sbjct: 351 KLVKGGGCPHADWWNAIVEKFQGIKNGDMIVNYGLVGMLTLVAVSTWQ 398