BLASTX nr result
ID: Chrysanthemum21_contig00030433
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00030433 (485 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021979057.1| enhanced ethylene response protein 5 [Helian... 62 9e-09 gb|OTG13435.1| hypothetical protein HannXRQ_Chr09g0238111 [Helia... 62 1e-08 gb|KVI01201.1| hypothetical protein Ccrd_020538 [Cynara carduncu... 62 3e-08 ref|XP_023757113.1| enhanced ethylene response protein 5 [Lactuc... 62 3e-08 gb|ESR64691.1| hypothetical protein CICLE_v10008462mg [Citrus cl... 60 1e-07 gb|KDO57748.1| hypothetical protein CISIN_1g015089mg [Citrus sin... 60 1e-07 ref|XP_006451452.1| enhanced ethylene response protein 5 isoform... 60 1e-07 dbj|GAY56158.1| hypothetical protein CUMW_169720 [Citrus unshiu] 60 1e-07 dbj|GAV68321.1| PCI domain-containing protein [Cephalotus follic... 60 1e-07 ref|XP_019249149.1| PREDICTED: enhanced ethylene response protei... 60 1e-07 ref|XP_009796546.1| PREDICTED: PCI domain-containing protein 2 [... 60 1e-07 ref|XP_009598554.1| PREDICTED: enhanced ethylene response protei... 60 1e-07 ref|XP_006451453.1| enhanced ethylene response protein 5 isoform... 60 1e-07 ref|XP_015083011.1| PREDICTED: PCI domain-containing protein 2 [... 60 1e-07 ref|XP_006346560.1| PREDICTED: PCI domain-containing protein 2 [... 60 1e-07 ref|XP_004243760.1| PREDICTED: enhanced ethylene response protei... 60 1e-07 ref|XP_023914080.1| enhanced ethylene response protein 5 [Quercu... 60 1e-07 ref|XP_019103120.1| PREDICTED: enhanced ethylene response protei... 60 2e-07 gb|KMS95488.1| hypothetical protein BVRB_007760 [Beta vulgaris s... 60 2e-07 ref|XP_021751267.1| enhanced ethylene response protein 5-like [C... 60 2e-07 >ref|XP_021979057.1| enhanced ethylene response protein 5 [Helianthus annuus] Length = 189 Score = 62.0 bits (149), Expect = 9e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 384 LCMQADRELASNGKTPEKLKAAGSFLMKVFGVLA 485 L +ADRELASNGKTPEKLKAAGSFLMKVFGVLA Sbjct: 131 LAEKADRELASNGKTPEKLKAAGSFLMKVFGVLA 164 >gb|OTG13435.1| hypothetical protein HannXRQ_Chr09g0238111 [Helianthus annuus] Length = 204 Score = 62.0 bits (149), Expect = 1e-08 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 384 LCMQADRELASNGKTPEKLKAAGSFLMKVFGVLA 485 L +ADRELASNGKTPEKLKAAGSFLMKVFGVLA Sbjct: 131 LAEKADRELASNGKTPEKLKAAGSFLMKVFGVLA 164 >gb|KVI01201.1| hypothetical protein Ccrd_020538 [Cynara cardunculus var. scolymus] Length = 354 Score = 62.0 bits (149), Expect = 3e-08 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 384 LCMQADRELASNGKTPEKLKAAGSFLMKVFGVLA 485 L +ADRELASNGKTPEKLKAAGSFLMKVFGVLA Sbjct: 131 LAERADRELASNGKTPEKLKAAGSFLMKVFGVLA 164 >ref|XP_023757113.1| enhanced ethylene response protein 5 [Lactuca sativa] gb|PLY98965.1| hypothetical protein LSAT_7X37341 [Lactuca sativa] Length = 414 Score = 62.0 bits (149), Expect = 3e-08 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 384 LCMQADRELASNGKTPEKLKAAGSFLMKVFGVLA 485 L +ADRELASNGKTPEKLKAAGSFLMKVFGVLA Sbjct: 131 LAERADRELASNGKTPEKLKAAGSFLMKVFGVLA 164 >gb|ESR64691.1| hypothetical protein CICLE_v10008462mg [Citrus clementina] gb|KDO57749.1| hypothetical protein CISIN_1g015089mg [Citrus sinensis] gb|KDO57750.1| hypothetical protein CISIN_1g015089mg [Citrus sinensis] Length = 328 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 384 LCMQADRELASNGKTPEKLKAAGSFLMKVFGVLA 485 L +ADRELASNGK+PEKLKAAGSFLMKVFGVLA Sbjct: 130 LAERADRELASNGKSPEKLKAAGSFLMKVFGVLA 163 >gb|KDO57748.1| hypothetical protein CISIN_1g015089mg [Citrus sinensis] Length = 357 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 384 LCMQADRELASNGKTPEKLKAAGSFLMKVFGVLA 485 L +ADRELASNGK+PEKLKAAGSFLMKVFGVLA Sbjct: 130 LAERADRELASNGKSPEKLKAAGSFLMKVFGVLA 163 >ref|XP_006451452.1| enhanced ethylene response protein 5 isoform X2 [Citrus clementina] ref|XP_006475433.1| PREDICTED: enhanced ethylene response protein 5 isoform X2 [Citrus sinensis] gb|ESR64692.1| hypothetical protein CICLE_v10008462mg [Citrus clementina] Length = 380 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 384 LCMQADRELASNGKTPEKLKAAGSFLMKVFGVLA 485 L +ADRELASNGK+PEKLKAAGSFLMKVFGVLA Sbjct: 130 LAERADRELASNGKSPEKLKAAGSFLMKVFGVLA 163 >dbj|GAY56158.1| hypothetical protein CUMW_169720 [Citrus unshiu] Length = 382 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 384 LCMQADRELASNGKTPEKLKAAGSFLMKVFGVLA 485 L +ADRELASNGK+PEKLKAAGSFLMKVFGVLA Sbjct: 130 LAERADRELASNGKSPEKLKAAGSFLMKVFGVLA 163 >dbj|GAV68321.1| PCI domain-containing protein [Cephalotus follicularis] Length = 407 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 384 LCMQADRELASNGKTPEKLKAAGSFLMKVFGVLA 485 L +ADRELASNGK+PEKLKAAGSFLMKVFGVLA Sbjct: 124 LAERADRELASNGKSPEKLKAAGSFLMKVFGVLA 157 >ref|XP_019249149.1| PREDICTED: enhanced ethylene response protein 5 [Nicotiana attenuata] gb|OIS99903.1| enhanced ethylene response protein 5 [Nicotiana attenuata] Length = 413 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +3 Query: 384 LCMQADRELASNGKTPEKLKAAGSFLMKVFGVLA 485 L +ADRELASNGKTPEKLK AGSFLMKVFGVLA Sbjct: 130 LAERADRELASNGKTPEKLKGAGSFLMKVFGVLA 163 >ref|XP_009796546.1| PREDICTED: PCI domain-containing protein 2 [Nicotiana sylvestris] ref|XP_016444115.1| PREDICTED: enhanced ethylene response protein 5-like [Nicotiana tabacum] Length = 413 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +3 Query: 384 LCMQADRELASNGKTPEKLKAAGSFLMKVFGVLA 485 L +ADRELASNGKTPEKLK AGSFLMKVFGVLA Sbjct: 130 LAERADRELASNGKTPEKLKGAGSFLMKVFGVLA 163 >ref|XP_009598554.1| PREDICTED: enhanced ethylene response protein 5 [Nicotiana tomentosiformis] ref|XP_016479659.1| PREDICTED: enhanced ethylene response protein 5-like [Nicotiana tabacum] Length = 413 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +3 Query: 384 LCMQADRELASNGKTPEKLKAAGSFLMKVFGVLA 485 L +ADRELASNGKTPEKLK AGSFLMKVFGVLA Sbjct: 130 LAERADRELASNGKTPEKLKGAGSFLMKVFGVLA 163 >ref|XP_006451453.1| enhanced ethylene response protein 5 isoform X1 [Citrus clementina] ref|XP_006451454.1| enhanced ethylene response protein 5 isoform X1 [Citrus clementina] ref|XP_006475431.1| PREDICTED: enhanced ethylene response protein 5 isoform X1 [Citrus sinensis] ref|XP_006475432.1| PREDICTED: enhanced ethylene response protein 5 isoform X1 [Citrus sinensis] gb|ESR64693.1| hypothetical protein CICLE_v10008462mg [Citrus clementina] gb|ESR64694.1| hypothetical protein CICLE_v10008462mg [Citrus clementina] gb|KDO57747.1| hypothetical protein CISIN_1g015089mg [Citrus sinensis] dbj|GAY56159.1| hypothetical protein CUMW_169720 [Citrus unshiu] dbj|GAY56160.1| hypothetical protein CUMW_169720 [Citrus unshiu] Length = 413 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 384 LCMQADRELASNGKTPEKLKAAGSFLMKVFGVLA 485 L +ADRELASNGK+PEKLKAAGSFLMKVFGVLA Sbjct: 130 LAERADRELASNGKSPEKLKAAGSFLMKVFGVLA 163 >ref|XP_015083011.1| PREDICTED: PCI domain-containing protein 2 [Solanum pennellii] Length = 415 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +3 Query: 384 LCMQADRELASNGKTPEKLKAAGSFLMKVFGVLA 485 L +ADRELASNGKTPEKLK AGSFLMKVFGVLA Sbjct: 132 LAERADRELASNGKTPEKLKGAGSFLMKVFGVLA 165 >ref|XP_006346560.1| PREDICTED: PCI domain-containing protein 2 [Solanum tuberosum] Length = 415 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +3 Query: 384 LCMQADRELASNGKTPEKLKAAGSFLMKVFGVLA 485 L +ADRELASNGKTPEKLK AGSFLMKVFGVLA Sbjct: 132 LAERADRELASNGKTPEKLKGAGSFLMKVFGVLA 165 >ref|XP_004243760.1| PREDICTED: enhanced ethylene response protein 5 [Solanum lycopersicum] Length = 415 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +3 Query: 384 LCMQADRELASNGKTPEKLKAAGSFLMKVFGVLA 485 L +ADRELASNGKTPEKLK AGSFLMKVFGVLA Sbjct: 132 LAERADRELASNGKTPEKLKGAGSFLMKVFGVLA 165 >ref|XP_023914080.1| enhanced ethylene response protein 5 [Quercus suber] gb|POF08601.1| enhanced ethylene response protein 5 [Quercus suber] Length = 416 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 384 LCMQADRELASNGKTPEKLKAAGSFLMKVFGVLA 485 L +ADRELASNGK+PEKLKAAGSFLMKVFGVLA Sbjct: 133 LAERADRELASNGKSPEKLKAAGSFLMKVFGVLA 166 >ref|XP_019103120.1| PREDICTED: enhanced ethylene response protein 5 isoform X2 [Beta vulgaris subsp. vulgaris] Length = 382 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 393 QADRELASNGKTPEKLKAAGSFLMKVFGVLA 485 +ADRELASNGKTP+KLKAAGSFLMKVFGVLA Sbjct: 127 RADRELASNGKTPDKLKAAGSFLMKVFGVLA 157 >gb|KMS95488.1| hypothetical protein BVRB_007760 [Beta vulgaris subsp. vulgaris] Length = 402 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 393 QADRELASNGKTPEKLKAAGSFLMKVFGVLA 485 +ADRELASNGKTP+KLKAAGSFLMKVFGVLA Sbjct: 122 RADRELASNGKTPDKLKAAGSFLMKVFGVLA 152 >ref|XP_021751267.1| enhanced ethylene response protein 5-like [Chenopodium quinoa] Length = 407 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 393 QADRELASNGKTPEKLKAAGSFLMKVFGVLA 485 +ADRELASNGKTP+KLKAAGSFLMKVFGVLA Sbjct: 127 RADRELASNGKTPDKLKAAGSFLMKVFGVLA 157