BLASTX nr result
ID: Chrysanthemum21_contig00030272
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00030272 (414 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI00124.1| hypothetical protein Ccrd_021575, partial [Cynara... 68 2e-10 >gb|KVI00124.1| hypothetical protein Ccrd_021575, partial [Cynara cardunculus var. scolymus] Length = 648 Score = 67.8 bits (164), Expect = 2e-10 Identities = 32/48 (66%), Positives = 39/48 (81%) Frame = -3 Query: 412 DMSTNTRADKYKQNLERFLRTKREPIVDSLVVISGIPKEKRLPSSGSI 269 D T+T D+YKQNL+RFLRTKRE +D +V+ SGIPKEKRLPSS S+ Sbjct: 565 DTITSTNVDRYKQNLDRFLRTKREAAMDPVVINSGIPKEKRLPSSRSL 612