BLASTX nr result
ID: Chrysanthemum21_contig00030271
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00030271 (367 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI00124.1| hypothetical protein Ccrd_021575, partial [Cynara... 91 1e-18 gb|OTG37433.1| putative P-loop containing nucleoside triphosphat... 66 4e-10 ref|XP_021978952.1| P-loop NTPase domain-containing protein LPA1... 66 4e-10 >gb|KVI00124.1| hypothetical protein Ccrd_021575, partial [Cynara cardunculus var. scolymus] Length = 648 Score = 90.5 bits (223), Expect = 1e-18 Identities = 50/74 (67%), Positives = 56/74 (75%) Frame = -3 Query: 365 LRTKREPVVDSLAVNSGIPKEKRLPSSGSLRVRGRSYSISASAKKEQSSPPASRTSSLVT 186 LRTKRE +D + +NSGIPKEKRLPSS SLRVRGRSYSIS SAK+E +PP SRTSS Sbjct: 583 LRTKREAAMDPVVINSGIPKEKRLPSSRSLRVRGRSYSISTSAKEELLTPPISRTSS--- 639 Query: 185 GGILRRPVSSGSRS 144 PVSSGSR+ Sbjct: 640 -----PPVSSGSRT 648 >gb|OTG37433.1| putative P-loop containing nucleoside triphosphate hydrolase [Helianthus annuus] Length = 701 Score = 66.2 bits (160), Expect = 4e-10 Identities = 37/54 (68%), Positives = 41/54 (75%) Frame = -3 Query: 356 KREPVVDSLAVNSGIPKEKRLPSSGSLRVRGRSYSISASAKKEQSSPPASRTSS 195 K EPV+DSL VN+ KRLPSSGSLRVRGRSYSIS+S K E+ S P SR SS Sbjct: 647 KDEPVMDSLVVNA-----KRLPSSGSLRVRGRSYSISSSVKDERVSTPVSRASS 695 >ref|XP_021978952.1| P-loop NTPase domain-containing protein LPA1 homolog 2-like [Helianthus annuus] Length = 740 Score = 66.2 bits (160), Expect = 4e-10 Identities = 37/54 (68%), Positives = 41/54 (75%) Frame = -3 Query: 356 KREPVVDSLAVNSGIPKEKRLPSSGSLRVRGRSYSISASAKKEQSSPPASRTSS 195 K EPV+DSL VN+ KRLPSSGSLRVRGRSYSIS+S K E+ S P SR SS Sbjct: 686 KDEPVMDSLVVNA-----KRLPSSGSLRVRGRSYSISSSVKDERVSTPVSRASS 734