BLASTX nr result
ID: Chrysanthemum21_contig00030152
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00030152 (375 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEA86307.1| probable WRKY transcription factor, partial [Sola... 110 3e-28 gb|KVH94112.1| DNA-binding WRKY [Cynara cardunculus var. scolymus] 114 4e-27 gb|ACY24211.1| WRKY transcription factor 7, partial [Bactris bro... 104 2e-26 gb|PLY77691.1| hypothetical protein LSAT_9X14580 [Lactuca sativa] 112 3e-26 ref|XP_023728872.1| WRKY transcription factor WRKY24, partial [L... 112 3e-26 gb|OVA17217.1| DNA-binding WRKY [Macleaya cordata] 112 3e-26 gb|AKE48871.1| WRKY transcription factor 7, partial [Desmoncus p... 102 5e-26 gb|AKE48851.1| WRKY transcription factor 7, partial [Astrocaryum... 102 5e-26 gb|AKE48840.1| WRKY transcription factor 7, partial [Acrocomia a... 102 5e-26 ref|XP_021977846.1| probable WRKY transcription factor 26 [Helia... 110 1e-25 gb|AKE33897.1| WRKY transcription factor 7, partial [Astrocaryum... 102 1e-25 gb|AKE33895.1| WRKY transcription factor 7, partial [Astrocaryum... 102 1e-25 gb|AKE48858.1| WRKY transcription factor 7, partial [Bactris bro... 100 1e-25 gb|AKE48861.1| WRKY transcription factor 7, partial [Bactris con... 100 2e-25 gb|ACY24210.1| WRKY transcription factor 7, partial [Attalea sp.... 102 2e-25 gb|ACY24207.1| WRKY transcription factor 7, partial [Attalea sea... 102 2e-25 gb|AKE48876.1| WRKY transcription factor 7, partial [Reinhardtia... 102 2e-25 gb|AKE33893.1| WRKY transcription factor 7, partial [Astrocaryum... 102 2e-25 gb|AKE33874.1| WRKY transcription factor 7, partial [Astrocaryum... 102 2e-25 gb|ACY24195.1| WRKY transcription factor 7, partial [Attalea bur... 102 2e-25 >gb|AEA86307.1| probable WRKY transcription factor, partial [Solanum nigrum] Length = 154 Score = 110 bits (274), Expect = 3e-28 Identities = 49/57 (85%), Positives = 55/57 (96%) Frame = +2 Query: 62 WRRASENEGISMIGGTRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRN 232 W+R SE+EG+S +GG+RTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPR+ Sbjct: 91 WKRESESEGLSALGGSRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRS 147 >gb|KVH94112.1| DNA-binding WRKY [Cynara cardunculus var. scolymus] Length = 546 Score = 114 bits (285), Expect = 4e-27 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = +2 Query: 68 RASENEGISMIGGTRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRN 232 RASENEGISMIGGTRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPR+ Sbjct: 352 RASENEGISMIGGTRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRS 406 >gb|ACY24211.1| WRKY transcription factor 7, partial [Bactris brongniartii] Length = 125 Score = 104 bits (260), Expect = 2e-26 Identities = 46/57 (80%), Positives = 51/57 (89%) Frame = +2 Query: 62 WRRASENEGISMIGGTRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRN 232 W++ ENEG+S G +TVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPR+ Sbjct: 62 WKKEGENEGVSAASGNKTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRS 118 >gb|PLY77691.1| hypothetical protein LSAT_9X14580 [Lactuca sativa] Length = 537 Score = 112 bits (279), Expect = 3e-26 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = +2 Query: 68 RASENEGISMIGGTRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRN 232 RASENEGIS IGGTRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPR+ Sbjct: 335 RASENEGISTIGGTRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRS 389 >ref|XP_023728872.1| WRKY transcription factor WRKY24, partial [Lactuca sativa] Length = 589 Score = 112 bits (279), Expect = 3e-26 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = +2 Query: 68 RASENEGISMIGGTRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRN 232 RASENEGIS IGGTRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPR+ Sbjct: 387 RASENEGISTIGGTRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRS 441 >gb|OVA17217.1| DNA-binding WRKY [Macleaya cordata] Length = 616 Score = 112 bits (279), Expect = 3e-26 Identities = 51/57 (89%), Positives = 55/57 (96%) Frame = +2 Query: 62 WRRASENEGISMIGGTRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRN 232 W++ SENEGIS IGG+RTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPR+ Sbjct: 382 WKKDSENEGISAIGGSRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRS 438 >gb|AKE48871.1| WRKY transcription factor 7, partial [Desmoncus polyacanthos] Length = 74 Score = 102 bits (253), Expect = 5e-26 Identities = 48/57 (84%), Positives = 51/57 (89%) Frame = +2 Query: 62 WRRASENEGISMIGGTRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRN 232 W++ ENEGIS G RTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPR+ Sbjct: 17 WKKEGENEGISA-SGNRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRS 72 >gb|AKE48851.1| WRKY transcription factor 7, partial [Astrocaryum mexicanum] Length = 75 Score = 102 bits (253), Expect = 5e-26 Identities = 48/57 (84%), Positives = 51/57 (89%) Frame = +2 Query: 62 WRRASENEGISMIGGTRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRN 232 W++ ENEGIS G RTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPR+ Sbjct: 18 WKKEGENEGISA-SGNRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRS 73 >gb|AKE48840.1| WRKY transcription factor 7, partial [Acrocomia aculeata] Length = 77 Score = 102 bits (253), Expect = 5e-26 Identities = 48/57 (84%), Positives = 51/57 (89%) Frame = +2 Query: 62 WRRASENEGISMIGGTRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRN 232 W++ ENEGIS G RTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPR+ Sbjct: 19 WKKEGENEGISA-SGNRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRS 74 >ref|XP_021977846.1| probable WRKY transcription factor 26 [Helianthus annuus] gb|OTG18950.1| putative WRKY DNA-binding protein 33 [Helianthus annuus] Length = 560 Score = 110 bits (274), Expect = 1e-25 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = +2 Query: 68 RASENEGISMIGGTRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRN 232 + SENEGISMIGGT+TVREPR+VVQTTSDIDILDDGYRWRKYGQKVVKGNPNPR+ Sbjct: 361 KVSENEGISMIGGTKTVREPRIVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRS 415 >gb|AKE33897.1| WRKY transcription factor 7, partial [Astrocaryum sciophilum] Length = 112 Score = 102 bits (253), Expect = 1e-25 Identities = 48/57 (84%), Positives = 51/57 (89%) Frame = +2 Query: 62 WRRASENEGISMIGGTRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRN 232 W++ ENEGIS G RTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPR+ Sbjct: 52 WKKEGENEGISA-SGNRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRS 107 >gb|AKE33895.1| WRKY transcription factor 7, partial [Astrocaryum gynacanthum] Length = 112 Score = 102 bits (253), Expect = 1e-25 Identities = 48/57 (84%), Positives = 51/57 (89%) Frame = +2 Query: 62 WRRASENEGISMIGGTRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRN 232 W++ ENEGIS G RTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPR+ Sbjct: 52 WKKEGENEGISA-SGNRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRS 107 >gb|AKE48858.1| WRKY transcription factor 7, partial [Bactris brongniartii] Length = 76 Score = 100 bits (250), Expect = 1e-25 Identities = 47/57 (82%), Positives = 51/57 (89%) Frame = +2 Query: 62 WRRASENEGISMIGGTRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRN 232 W++ ENEGIS G +TVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPR+ Sbjct: 19 WKKEGENEGISA-SGNKTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRS 74 >gb|AKE48861.1| WRKY transcription factor 7, partial [Bactris concinna] Length = 77 Score = 100 bits (250), Expect = 2e-25 Identities = 47/57 (82%), Positives = 51/57 (89%) Frame = +2 Query: 62 WRRASENEGISMIGGTRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRN 232 W++ ENEGIS G +TVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPR+ Sbjct: 19 WKKEGENEGISA-SGNKTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRS 74 >gb|ACY24210.1| WRKY transcription factor 7, partial [Attalea sp. Noblick 5517] Length = 116 Score = 102 bits (253), Expect = 2e-25 Identities = 48/57 (84%), Positives = 51/57 (89%) Frame = +2 Query: 62 WRRASENEGISMIGGTRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRN 232 W++ ENEGIS G RTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPR+ Sbjct: 56 WKKEGENEGISA-SGNRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRS 111 >gb|ACY24207.1| WRKY transcription factor 7, partial [Attalea seabrensis] Length = 116 Score = 102 bits (253), Expect = 2e-25 Identities = 48/57 (84%), Positives = 51/57 (89%) Frame = +2 Query: 62 WRRASENEGISMIGGTRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRN 232 W++ ENEGIS G RTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPR+ Sbjct: 55 WKKEGENEGISA-SGNRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRS 110 >gb|AKE48876.1| WRKY transcription factor 7, partial [Reinhardtia gracilis var. rostrata] Length = 117 Score = 102 bits (253), Expect = 2e-25 Identities = 48/57 (84%), Positives = 51/57 (89%) Frame = +2 Query: 62 WRRASENEGISMIGGTRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRN 232 W++ ENEGIS G RTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPR+ Sbjct: 60 WKKEGENEGISA-SGNRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRS 115 >gb|AKE33893.1| WRKY transcription factor 7, partial [Astrocaryum mexicanum] Length = 117 Score = 102 bits (253), Expect = 2e-25 Identities = 48/57 (84%), Positives = 51/57 (89%) Frame = +2 Query: 62 WRRASENEGISMIGGTRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRN 232 W++ ENEGIS G RTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPR+ Sbjct: 52 WKKEGENEGISA-SGNRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRS 107 >gb|AKE33874.1| WRKY transcription factor 7, partial [Astrocaryum alatum] gb|AKE33879.1| WRKY transcription factor 7, partial [Astrocaryum ciliatum] gb|AKE33885.1| WRKY transcription factor 7, partial [Astrocaryum gynacanthum] gb|AKE33886.1| WRKY transcription factor 7, partial [Astrocaryum gynacanthum] gb|AKE33887.1| WRKY transcription factor 7, partial [Astrocaryum gynacanthum] gb|AKE33896.1| WRKY transcription factor 7, partial [Astrocaryum sciophilum] gb|AKE33898.1| WRKY transcription factor 7, partial [Astrocaryum sciophilum] gb|AKE33902.1| WRKY transcription factor 7, partial [Astrocaryum vulgare] gb|AKE33903.1| WRKY transcription factor 7, partial [Astrocaryum vulgare] gb|AKE33904.1| WRKY transcription factor 7, partial [Astrocaryum vulgare] Length = 117 Score = 102 bits (253), Expect = 2e-25 Identities = 48/57 (84%), Positives = 51/57 (89%) Frame = +2 Query: 62 WRRASENEGISMIGGTRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRN 232 W++ ENEGIS G RTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPR+ Sbjct: 52 WKKEGENEGISA-SGNRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRS 107 >gb|ACY24195.1| WRKY transcription factor 7, partial [Attalea burretiana] gb|ACY24203.1| WRKY transcription factor 7, partial [Attalea oleifera] Length = 117 Score = 102 bits (253), Expect = 2e-25 Identities = 48/57 (84%), Positives = 51/57 (89%) Frame = +2 Query: 62 WRRASENEGISMIGGTRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRN 232 W++ ENEGIS G RTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPR+ Sbjct: 55 WKKEGENEGISA-SGNRTVREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRS 110