BLASTX nr result
ID: Chrysanthemum21_contig00029970
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00029970 (371 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023761456.1| RNA polymerase sigma factor sigE, chloroplas... 58 4e-07 >ref|XP_023761456.1| RNA polymerase sigma factor sigE, chloroplastic/mitochondrial [Lactuca sativa] ref|XP_023761457.1| RNA polymerase sigma factor sigE, chloroplastic/mitochondrial [Lactuca sativa] gb|PLY87284.1| hypothetical protein LSAT_4X164620 [Lactuca sativa] Length = 515 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/64 (46%), Positives = 41/64 (64%) Frame = +2 Query: 14 LEREPTDGELAAATNMNVSQVRKQIVLGQAETN*LMRDKKGNLIDFWIRHWNVAIKAATF 193 LEREPTDGELA ATNMNVSQ+RKQI +GQA N L++ ++ +++ F Sbjct: 247 LEREPTDGELAEATNMNVSQLRKQIGIGQAARNKLIKHNLRLVLFVMNKYFQEFANGRNF 306 Query: 194 KNIC 205 ++ C Sbjct: 307 QDFC 310