BLASTX nr result
ID: Chrysanthemum21_contig00029782
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00029782 (518 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_036872230.1| hypothetical protein [Prevotella buccalis] >... 56 6e-06 >ref|WP_036872230.1| hypothetical protein [Prevotella buccalis] gb|KGF35770.1| hypothetical protein HMPREF2137_04240 [Prevotella buccalis DNF00853] Length = 358 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/68 (42%), Positives = 34/68 (50%) Frame = -1 Query: 512 P*KFYQSPARRYETP*RRYKTPPRLYKSPSRRNKKTPRVYKTPARLYQIP*KVYIYPRES 333 P + Y SP+R Y P R Y P R Y SPSR R Y P R Y +P + Y P S Sbjct: 274 PSRSYSSPSRSYSPPSRSYSPPSRSYSSPSRSYSSPSRSYSPPYRSYSVPSRSYSSPSRS 333 Query: 332 SSRLSRNG 309 S SR+G Sbjct: 334 YSSPSRSG 341