BLASTX nr result
ID: Chrysanthemum21_contig00029553
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00029553 (356 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021989596.1| pentatricopeptide repeat-containing protein ... 91 7e-19 ref|XP_023765352.1| pentatricopeptide repeat-containing protein ... 84 3e-16 ref|XP_023765351.1| pentatricopeptide repeat-containing protein ... 84 3e-16 ref|XP_021980529.1| pentatricopeptide repeat-containing protein ... 83 3e-16 ref|XP_021997519.1| pentatricopeptide repeat-containing protein ... 80 4e-15 ref|XP_021997518.1| pentatricopeptide repeat-containing protein ... 80 5e-15 ref|XP_010646821.1| PREDICTED: pentatricopeptide repeat-containi... 79 1e-14 ref|XP_010646933.1| PREDICTED: pentatricopeptide repeat-containi... 79 1e-14 ref|XP_002531031.2| PREDICTED: pentatricopeptide repeat-containi... 70 1e-11 ref|XP_017256763.1| PREDICTED: pentatricopeptide repeat-containi... 68 9e-11 gb|KZM92510.1| hypothetical protein DCAR_020125 [Daucus carota s... 68 1e-10 gb|ONK69594.1| uncharacterized protein A4U43_C05F24610 [Asparagu... 66 2e-10 gb|EXB55400.1| hypothetical protein L484_016768 [Morus notabilis] 67 2e-10 ref|XP_010094224.2| pentatricopeptide repeat-containing protein ... 67 2e-10 ref|XP_011626235.2| pentatricopeptide repeat-containing protein ... 66 3e-10 ref|XP_020527679.1| pentatricopeptide repeat-containing protein ... 66 3e-10 ref|XP_020264679.1| pentatricopeptide repeat-containing protein ... 66 3e-10 gb|PON75911.1| Pentatricopeptide repeat [Parasponia andersonii] 66 5e-10 ref|XP_020532255.1| putative pentatricopeptide repeat-containing... 66 5e-10 gb|PON79551.1| Pentatricopeptide repeat [Trema orientalis] 65 6e-10 >ref|XP_021989596.1| pentatricopeptide repeat-containing protein At5g06540-like [Helianthus annuus] ref|XP_021989597.1| pentatricopeptide repeat-containing protein At5g06540-like [Helianthus annuus] gb|OTG12331.1| putative tetratricopeptide-like helical domain-containing protein [Helianthus annuus] Length = 516 Score = 90.9 bits (224), Expect = 7e-19 Identities = 44/68 (64%), Positives = 51/68 (75%), Gaps = 4/68 (5%) Frame = +3 Query: 15 WVRLRNM----GSWEGVINLRNMMKKRKVDTAPGWSFIEVDGIFHKFLVSDQCHLQVKDL 182 +V L NM GSWEGVI LR MM +RKV APGWSFIEV+GI +KF V DQCH Q KD+ Sbjct: 444 YVGLANMYASNGSWEGVIKLRKMMTERKVAIAPGWSFIEVNGIVNKFFVDDQCHPQAKDI 503 Query: 183 HEILQLLN 206 H++L LLN Sbjct: 504 HDVLMLLN 511 >ref|XP_023765352.1| pentatricopeptide repeat-containing protein At5g06540-like isoform X2 [Lactuca sativa] gb|PLY84324.1| hypothetical protein LSAT_5X85060 [Lactuca sativa] Length = 494 Score = 83.6 bits (205), Expect = 3e-16 Identities = 43/69 (62%), Positives = 47/69 (68%), Gaps = 4/69 (5%) Frame = +3 Query: 15 WVRLRNM----GSWEGVINLRNMMKKRKVDTAPGWSFIEVDGIFHKFLVSDQCHLQVKDL 182 +V L NM G WE VI LRNMM +RKVD P WSFIEVDG HKF V DQ H + DL Sbjct: 421 YVGLANMYADVGRWENVIRLRNMMVERKVDNTPSWSFIEVDGGVHKFFVHDQFHPRANDL 480 Query: 183 HEILQLLNK 209 EILQ+LNK Sbjct: 481 REILQVLNK 489 >ref|XP_023765351.1| pentatricopeptide repeat-containing protein At5g06540-like isoform X1 [Lactuca sativa] Length = 517 Score = 83.6 bits (205), Expect = 3e-16 Identities = 43/69 (62%), Positives = 47/69 (68%), Gaps = 4/69 (5%) Frame = +3 Query: 15 WVRLRNM----GSWEGVINLRNMMKKRKVDTAPGWSFIEVDGIFHKFLVSDQCHLQVKDL 182 +V L NM G WE VI LRNMM +RKVD P WSFIEVDG HKF V DQ H + DL Sbjct: 444 YVGLANMYADVGRWENVIRLRNMMVERKVDNTPSWSFIEVDGGVHKFFVHDQFHPRANDL 503 Query: 183 HEILQLLNK 209 EILQ+LNK Sbjct: 504 REILQVLNK 512 >ref|XP_021980529.1| pentatricopeptide repeat-containing protein At3g62890-like [Helianthus annuus] gb|OTG16037.1| putative tetratricopeptide-like helical domain-containing protein [Helianthus annuus] Length = 368 Score = 82.8 bits (203), Expect = 3e-16 Identities = 41/68 (60%), Positives = 48/68 (70%), Gaps = 4/68 (5%) Frame = +3 Query: 15 WVRLRNM----GSWEGVINLRNMMKKRKVDTAPGWSFIEVDGIFHKFLVSDQCHLQVKDL 182 +V L NM GSWEGVI LR MM +RKV APGWSFIEV G +KF V + CH Q KD+ Sbjct: 296 YVGLANMYASNGSWEGVIKLRKMMTERKVAIAPGWSFIEVYGNVNKFFVDNHCHPQAKDI 355 Query: 183 HEILQLLN 206 H++L LLN Sbjct: 356 HDVLMLLN 363 >ref|XP_021997519.1| pentatricopeptide repeat-containing protein At5g66520-like isoform X2 [Helianthus annuus] gb|OTG04758.1| putative tetratricopeptide-like helical domain-containing protein [Helianthus annuus] Length = 500 Score = 80.1 bits (196), Expect = 4e-15 Identities = 39/67 (58%), Positives = 48/67 (71%), Gaps = 4/67 (5%) Frame = +3 Query: 15 WVRLRNM----GSWEGVINLRNMMKKRKVDTAPGWSFIEVDGIFHKFLVSDQCHLQVKDL 182 +V L NM GSWEG+I LR MM +R+V AP WSFIEV G +KF V DQCH Q KD+ Sbjct: 428 YVGLANMYASNGSWEGLIKLRKMMTERRVAIAPSWSFIEVYGNVNKFFVDDQCHPQAKDI 487 Query: 183 HEILQLL 203 H++L+LL Sbjct: 488 HDVLKLL 494 >ref|XP_021997518.1| pentatricopeptide repeat-containing protein At5g66520-like isoform X1 [Helianthus annuus] Length = 516 Score = 80.1 bits (196), Expect = 5e-15 Identities = 39/67 (58%), Positives = 48/67 (71%), Gaps = 4/67 (5%) Frame = +3 Query: 15 WVRLRNM----GSWEGVINLRNMMKKRKVDTAPGWSFIEVDGIFHKFLVSDQCHLQVKDL 182 +V L NM GSWEG+I LR MM +R+V AP WSFIEV G +KF V DQCH Q KD+ Sbjct: 444 YVGLANMYASNGSWEGLIKLRKMMTERRVAIAPSWSFIEVYGNVNKFFVDDQCHPQAKDI 503 Query: 183 HEILQLL 203 H++L+LL Sbjct: 504 HDVLKLL 510 >ref|XP_010646821.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like isoform X1 [Vitis vinifera] Length = 528 Score = 79.0 bits (193), Expect = 1e-14 Identities = 34/65 (52%), Positives = 48/65 (73%) Frame = +3 Query: 33 MGSWEGVINLRNMMKKRKVDTAPGWSFIEVDGIFHKFLVSDQCHLQVKDLHEILQLLNKF 212 MGSWEGV+ LR MMK+R V T P WSFIE++G+ HKFLV D+CH Q + ++ +L L + Sbjct: 457 MGSWEGVMRLRKMMKERGVLTVPAWSFIEINGVVHKFLVDDKCHPQWRYIYSVLNQLGRE 516 Query: 213 MN*YN 227 ++ +N Sbjct: 517 LDTFN 521 >ref|XP_010646933.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Length = 528 Score = 79.0 bits (193), Expect = 1e-14 Identities = 34/65 (52%), Positives = 48/65 (73%) Frame = +3 Query: 33 MGSWEGVINLRNMMKKRKVDTAPGWSFIEVDGIFHKFLVSDQCHLQVKDLHEILQLLNKF 212 MGSWEGV+ LR MMK+R V T P WSFIE++G+ HKFLV D+CH Q + ++ +L L + Sbjct: 457 MGSWEGVMRLRKMMKERGVLTVPAWSFIEINGVVHKFLVDDKCHPQWRYIYSVLNQLGRE 516 Query: 213 MN*YN 227 ++ +N Sbjct: 517 LDTFN 521 >ref|XP_002531031.2| PREDICTED: pentatricopeptide repeat-containing protein At5g48910 [Ricinus communis] Length = 530 Score = 70.5 bits (171), Expect = 1e-11 Identities = 34/75 (45%), Positives = 49/75 (65%), Gaps = 4/75 (5%) Frame = +3 Query: 15 WVRLRNM----GSWEGVINLRNMMKKRKVDTAPGWSFIEVDGIFHKFLVSDQCHLQVKDL 182 +V L NM G W+ VI LR +MK+R + T WSFIE+DGI HKFLV D+ H +D+ Sbjct: 447 YVLLSNMYATKGCWDEVIRLRKIMKERGIVTVSAWSFIEIDGIVHKFLVDDKAHSYYRDM 506 Query: 183 HEILQLLNKFMN*YN 227 ++ L LN+ ++ Y+ Sbjct: 507 YKFLNQLNEQLDSYS 521 >ref|XP_017256763.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Daucus carota subsp. sativus] Length = 445 Score = 67.8 bits (164), Expect = 9e-11 Identities = 32/69 (46%), Positives = 46/69 (66%), Gaps = 4/69 (5%) Frame = +3 Query: 15 WVRLRNM----GSWEGVINLRNMMKKRKVDTAPGWSFIEVDGIFHKFLVSDQCHLQVKDL 182 +V L NM G+WE V LR MMK ++V + PGWS IE+DGI ++F V D+ H KD+ Sbjct: 364 YVLLANMYATLGNWESVTRLRKMMKVKQVVSKPGWSSIEIDGITNRFTVDDKSHSHAKDI 423 Query: 183 HEILQLLNK 209 +++L LL + Sbjct: 424 YQLLSLLTR 432 >gb|KZM92510.1| hypothetical protein DCAR_020125 [Daucus carota subsp. sativus] Length = 697 Score = 67.8 bits (164), Expect = 1e-10 Identities = 32/69 (46%), Positives = 46/69 (66%), Gaps = 4/69 (5%) Frame = +3 Query: 15 WVRLRNM----GSWEGVINLRNMMKKRKVDTAPGWSFIEVDGIFHKFLVSDQCHLQVKDL 182 +V L NM G+WE V LR MMK ++V + PGWS IE+DGI ++F V D+ H KD+ Sbjct: 616 YVLLANMYATLGNWESVTRLRKMMKVKQVVSKPGWSSIEIDGITNRFTVDDKSHSHAKDI 675 Query: 183 HEILQLLNK 209 +++L LL + Sbjct: 676 YQLLSLLTR 684 >gb|ONK69594.1| uncharacterized protein A4U43_C05F24610 [Asparagus officinalis] Length = 280 Score = 66.2 bits (160), Expect = 2e-10 Identities = 27/58 (46%), Positives = 43/58 (74%) Frame = +3 Query: 33 MGSWEGVINLRNMMKKRKVDTAPGWSFIEVDGIFHKFLVSDQCHLQVKDLHEILQLLN 206 +G WEGV+ +R M++R V PGWS IEVDG+ H+FLV D+ H Q+ ++ ++L+L++ Sbjct: 212 VGRWEGVMEVRRAMRERGVKITPGWSLIEVDGVGHRFLVDDKVHPQLGEISKMLELVS 269 >gb|EXB55400.1| hypothetical protein L484_016768 [Morus notabilis] Length = 508 Score = 66.6 bits (161), Expect = 2e-10 Identities = 31/75 (41%), Positives = 51/75 (68%) Frame = +3 Query: 30 NMGSWEGVINLRNMMKKRKVDTAPGWSFIEVDGIFHKFLVSDQCHLQVKDLHEILQLLNK 209 +MG WE V+ LR MM++R+V + WSFIEVDG+ HKF+ D+ H +++ ++ IL L + Sbjct: 436 DMGCWEDVMRLRKMMEEREVVKSFAWSFIEVDGVVHKFVADDKSHPKLRSIYRILDQLKR 495 Query: 210 FMN*YNSSFLTLKLM 254 + SSF+T +++ Sbjct: 496 EL---KSSFITNEIV 507 >ref|XP_010094224.2| pentatricopeptide repeat-containing protein At2g42920, chloroplastic [Morus notabilis] Length = 531 Score = 66.6 bits (161), Expect = 2e-10 Identities = 31/75 (41%), Positives = 51/75 (68%) Frame = +3 Query: 30 NMGSWEGVINLRNMMKKRKVDTAPGWSFIEVDGIFHKFLVSDQCHLQVKDLHEILQLLNK 209 +MG WE V+ LR MM++R+V + WSFIEVDG+ HKF+ D+ H +++ ++ IL L + Sbjct: 459 DMGCWEDVMRLRKMMEEREVVKSFAWSFIEVDGVVHKFVADDKSHPKLRSIYRILDQLKR 518 Query: 210 FMN*YNSSFLTLKLM 254 + SSF+T +++ Sbjct: 519 EL---KSSFITNEIV 530 >ref|XP_011626235.2| pentatricopeptide repeat-containing protein At5g06540-like [Amborella trichopoda] Length = 489 Score = 66.2 bits (160), Expect = 3e-10 Identities = 29/58 (50%), Positives = 41/58 (70%) Frame = +3 Query: 36 GSWEGVINLRNMMKKRKVDTAPGWSFIEVDGIFHKFLVSDQCHLQVKDLHEILQLLNK 209 G WEGV+++R MM+KR V PG SFIE+ GI H+FLV D+ H Q +++++L L K Sbjct: 411 GKWEGVVDMRKMMRKRGVTIIPGHSFIEICGIAHRFLVDDKSHPQSNEIYQMLDQLTK 468 >ref|XP_020527679.1| pentatricopeptide repeat-containing protein At5g66520 isoform X1 [Amborella trichopoda] ref|XP_020527680.1| pentatricopeptide repeat-containing protein At5g66520 isoform X1 [Amborella trichopoda] ref|XP_020527681.1| pentatricopeptide repeat-containing protein At5g66520 isoform X1 [Amborella trichopoda] ref|XP_020527682.1| pentatricopeptide repeat-containing protein At5g66520 isoform X1 [Amborella trichopoda] ref|XP_020527683.1| pentatricopeptide repeat-containing protein At5g66520 isoform X1 [Amborella trichopoda] ref|XP_006852250.2| pentatricopeptide repeat-containing protein At5g66520 isoform X1 [Amborella trichopoda] ref|XP_020527684.1| pentatricopeptide repeat-containing protein At5g66520 isoform X1 [Amborella trichopoda] ref|XP_020527685.1| pentatricopeptide repeat-containing protein At5g66520 isoform X1 [Amborella trichopoda] ref|XP_020527686.1| pentatricopeptide repeat-containing protein At5g66520 isoform X1 [Amborella trichopoda] ref|XP_020527688.1| pentatricopeptide repeat-containing protein At5g66520 isoform X1 [Amborella trichopoda] Length = 521 Score = 66.2 bits (160), Expect = 3e-10 Identities = 30/58 (51%), Positives = 40/58 (68%) Frame = +3 Query: 36 GSWEGVINLRNMMKKRKVDTAPGWSFIEVDGIFHKFLVSDQCHLQVKDLHEILQLLNK 209 G WEGV+++R MMKKR V PG SFIE+ GI H FLV D+ H Q +++++L L K Sbjct: 452 GKWEGVVDMRIMMKKRGVAVVPGHSFIEIYGIVHSFLVDDKFHPQYNEIYQMLDQLTK 509 >ref|XP_020264679.1| pentatricopeptide repeat-containing protein At5g66520-like [Asparagus officinalis] Length = 533 Score = 66.2 bits (160), Expect = 3e-10 Identities = 27/58 (46%), Positives = 43/58 (74%) Frame = +3 Query: 33 MGSWEGVINLRNMMKKRKVDTAPGWSFIEVDGIFHKFLVSDQCHLQVKDLHEILQLLN 206 +G WEGV+ +R M++R V PGWS IEVDG+ H+FLV D+ H Q+ ++ ++L+L++ Sbjct: 465 VGRWEGVMEVRRAMRERGVKITPGWSLIEVDGVGHRFLVDDKVHPQLGEISKMLELVS 522 >gb|PON75911.1| Pentatricopeptide repeat [Parasponia andersonii] Length = 520 Score = 65.9 bits (159), Expect = 5e-10 Identities = 31/69 (44%), Positives = 44/69 (63%), Gaps = 4/69 (5%) Frame = +3 Query: 15 WVRLRNM----GSWEGVINLRNMMKKRKVDTAPGWSFIEVDGIFHKFLVSDQCHLQVKDL 182 +V L NM GSWE V+ LR MMK+R V T WSFIE+ G+ HKF+ D+ H Q ++ Sbjct: 438 YVLLSNMYATIGSWEEVMRLRKMMKQRNVVTVSAWSFIEISGVLHKFVADDKSHSQSSNI 497 Query: 183 HEILQLLNK 209 +++L L + Sbjct: 498 YKVLVQLKR 506 >ref|XP_020532255.1| putative pentatricopeptide repeat-containing protein At3g23330 [Amborella trichopoda] Length = 603 Score = 65.9 bits (159), Expect = 5e-10 Identities = 31/72 (43%), Positives = 46/72 (63%), Gaps = 4/72 (5%) Frame = +3 Query: 12 WWVRLRNM----GSWEGVINLRNMMKKRKVDTAPGWSFIEVDGIFHKFLVSDQCHLQVKD 179 W+V + N+ G W+GV +R +MK+R V PGWS+IEVDG H FLV+D H + Sbjct: 436 WYVLMSNIYATSGMWDGVAKMRTLMKQRNVLKLPGWSWIEVDGQIHNFLVADNSHPLSYE 495 Query: 180 LHEILQLLNKFM 215 +H++ + L+K M Sbjct: 496 IHKLTKDLDKRM 507 >gb|PON79551.1| Pentatricopeptide repeat [Trema orientalis] Length = 508 Score = 65.5 bits (158), Expect = 6e-10 Identities = 31/69 (44%), Positives = 44/69 (63%), Gaps = 4/69 (5%) Frame = +3 Query: 15 WVRLRNM----GSWEGVINLRNMMKKRKVDTAPGWSFIEVDGIFHKFLVSDQCHLQVKDL 182 +V L NM GSWE V+ LR MMK+R V T WSFIE+ G+ HKF+ D+ H Q ++ Sbjct: 424 YVLLSNMYATIGSWEEVMRLRKMMKQRNVVTISAWSFIEISGVLHKFVADDKSHSQSSNI 483 Query: 183 HEILQLLNK 209 +++L L + Sbjct: 484 YKVLVQLKR 492