BLASTX nr result
ID: Chrysanthemum21_contig00029199
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00029199 (460 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023735857.1| rho guanine nucleotide exchange factor 8-lik... 79 4e-14 gb|PLY72196.1| hypothetical protein LSAT_7X40760 [Lactuca sativa] 79 4e-14 ref|XP_022030272.1| rho guanine nucleotide exchange factor 8-lik... 72 9e-12 gb|KVI01250.1| Plant specific Rop nucleotide exchanger, PRONE [C... 66 9e-10 ref|XP_023769952.1| rho guanine nucleotide exchange factor 8-lik... 61 5e-08 ref|XP_018683162.1| PREDICTED: rho guanine nucleotide exchange f... 61 7e-08 ref|XP_009390696.2| PREDICTED: rho guanine nucleotide exchange f... 59 3e-07 ref|XP_008800346.1| PREDICTED: rho guanine nucleotide exchange f... 59 3e-07 ref|XP_016479746.1| PREDICTED: rho guanine nucleotide exchange f... 59 3e-07 ref|XP_009762343.1| PREDICTED: rho guanine nucleotide exchange f... 59 3e-07 ref|XP_020098184.1| rho guanine nucleotide exchange factor 8-lik... 59 3e-07 ref|XP_020098183.1| rho guanine nucleotide exchange factor 8-lik... 59 3e-07 ref|XP_021996617.1| rho guanine nucleotide exchange factor 8-lik... 59 5e-07 ref|XP_006465619.1| PREDICTED: rop guanine nucleotide exchange f... 59 5e-07 ref|XP_006426954.1| rop guanine nucleotide exchange factor 12 [C... 59 5e-07 gb|PNX87215.1| rho guanine nucleotide exchange factor 8-like pro... 56 6e-07 ref|XP_022559434.1| rop guanine nucleotide exchange factor 13-li... 58 6e-07 emb|CDY30136.1| BnaC05g37260D [Brassica napus] 58 6e-07 ref|XP_013637993.1| PREDICTED: LOW QUALITY PROTEIN: rop guanine ... 58 6e-07 gb|OAP05137.1| ROPGEF13 [Arabidopsis thaliana] 57 7e-07 >ref|XP_023735857.1| rho guanine nucleotide exchange factor 8-like [Lactuca sativa] Length = 472 Score = 79.0 bits (193), Expect = 4e-14 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = +1 Query: 19 MKEDSNKRWRKEVDWLLSVTDHIV*FVPVQHTARDRSNLEVI 144 MKEDS KRWRKEVDWLLS+TDHIV FVPVQHTARD SN+E++ Sbjct: 100 MKEDSKKRWRKEVDWLLSITDHIVEFVPVQHTARDGSNMEIM 141 >gb|PLY72196.1| hypothetical protein LSAT_7X40760 [Lactuca sativa] Length = 500 Score = 79.0 bits (193), Expect = 4e-14 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = +1 Query: 19 MKEDSNKRWRKEVDWLLSVTDHIV*FVPVQHTARDRSNLEVI 144 MKEDS KRWRKEVDWLLS+TDHIV FVPVQHTARD SN+E++ Sbjct: 100 MKEDSKKRWRKEVDWLLSITDHIVEFVPVQHTARDGSNMEIM 141 >ref|XP_022030272.1| rho guanine nucleotide exchange factor 8-like [Helianthus annuus] gb|OTG30195.1| putative PRONE domain-containing protein [Helianthus annuus] Length = 445 Score = 72.0 bits (175), Expect = 9e-12 Identities = 33/51 (64%), Positives = 41/51 (80%) Frame = +1 Query: 19 MKEDSNKRWRKEVDWLLSVTDHIV*FVPVQHTARDRSNLEVIYLPSC*DMV 171 MKEDS KRWRKEVDW+LSVT++I FVPVQHTARD SN+E++ D++ Sbjct: 117 MKEDSKKRWRKEVDWVLSVTNYISEFVPVQHTARDGSNMEIMVTKQRKDLI 167 >gb|KVI01250.1| Plant specific Rop nucleotide exchanger, PRONE [Cynara cardunculus var. scolymus] Length = 419 Score = 66.2 bits (160), Expect = 9e-10 Identities = 31/40 (77%), Positives = 32/40 (80%) Frame = +1 Query: 19 MKEDSNKRWRKEVDWLLSVTDHIV*FVPVQHTARDRSNLE 138 M ED RWRKEV WLLSVTDHIV FVP QHTARD SN+E Sbjct: 113 MPEDRKMRWRKEVRWLLSVTDHIVEFVPYQHTARDGSNME 152 >ref|XP_023769952.1| rho guanine nucleotide exchange factor 8-like [Lactuca sativa] gb|PLY80746.1| hypothetical protein LSAT_8X95381 [Lactuca sativa] Length = 442 Score = 61.2 bits (147), Expect = 5e-08 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +1 Query: 19 MKEDSNKRWRKEVDWLLSVTDHIV*FVPVQHTARDRSNLEVI 144 M ED KRWRKEV+WLLSVTD+IV FVP Q A+D SN+E++ Sbjct: 48 MPEDLKKRWRKEVNWLLSVTDNIVEFVPSQQQAKDGSNMEIM 89 >ref|XP_018683162.1| PREDICTED: rho guanine nucleotide exchange factor 8 [Musa acuminata subsp. malaccensis] Length = 539 Score = 60.8 bits (146), Expect = 7e-08 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +1 Query: 19 MKEDSNKRWRKEVDWLLSVTDHIV*FVPVQHTARDRSNLEVI 144 M + RWRKE+DWLLSVTDHIV FVP Q T++D SN+E++ Sbjct: 133 MPAERKARWRKEIDWLLSVTDHIVEFVPSQQTSKDGSNMEIM 174 >ref|XP_009390696.2| PREDICTED: rho guanine nucleotide exchange factor 8-like [Musa acuminata subsp. malaccensis] Length = 527 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = +1 Query: 19 MKEDSNKRWRKEVDWLLSVTDHIV*FVPVQHTARDRSNLEVI 144 M + RWRKE+DWLLSVTDHIV FVP + T++D SN+E++ Sbjct: 128 MAAERKTRWRKEIDWLLSVTDHIVEFVPSRQTSKDGSNMEIM 169 >ref|XP_008800346.1| PREDICTED: rho guanine nucleotide exchange factor 8-like [Phoenix dactylifera] ref|XP_017700317.1| PREDICTED: rho guanine nucleotide exchange factor 8-like [Phoenix dactylifera] Length = 537 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = +1 Query: 19 MKEDSNKRWRKEVDWLLSVTDHIV*FVPVQHTARDRSNLEVI 144 M + RWRKE+DWLLSVTDHIV FVP Q T++D S++E++ Sbjct: 137 MSAERKARWRKEIDWLLSVTDHIVEFVPSQQTSKDGSHMEIM 178 >ref|XP_016479746.1| PREDICTED: rho guanine nucleotide exchange factor 8-like [Nicotiana tabacum] Length = 510 Score = 58.9 bits (141), Expect = 3e-07 Identities = 26/51 (50%), Positives = 36/51 (70%) Frame = +1 Query: 19 MKEDSNKRWRKEVDWLLSVTDHIV*FVPVQHTARDRSNLEVIYLPSC*DMV 171 M + +RWRKE+DWLLSVTD+IV FVP Q A+D +N+E++ D+V Sbjct: 143 MSQKRKERWRKEIDWLLSVTDYIVEFVPAQQKAKDGTNMEIMVTQQRRDLV 193 >ref|XP_009762343.1| PREDICTED: rho guanine nucleotide exchange factor 8-like [Nicotiana sylvestris] Length = 510 Score = 58.9 bits (141), Expect = 3e-07 Identities = 26/51 (50%), Positives = 36/51 (70%) Frame = +1 Query: 19 MKEDSNKRWRKEVDWLLSVTDHIV*FVPVQHTARDRSNLEVIYLPSC*DMV 171 M + +RWRKE+DWLLSVTD+IV FVP Q A+D +N+E++ D+V Sbjct: 143 MSQKRKERWRKEIDWLLSVTDYIVEFVPAQQKAKDGTNMEIMVTQQRRDLV 193 >ref|XP_020098184.1| rho guanine nucleotide exchange factor 8-like isoform X2 [Ananas comosus] Length = 523 Score = 58.9 bits (141), Expect = 3e-07 Identities = 24/42 (57%), Positives = 33/42 (78%) Frame = +1 Query: 19 MKEDSNKRWRKEVDWLLSVTDHIV*FVPVQHTARDRSNLEVI 144 M + +RWRKE+DWLLSVTDHIV FVP Q ++D +N+E++ Sbjct: 143 MSAERKQRWRKEIDWLLSVTDHIVEFVPSQQVSKDGTNMEIM 184 >ref|XP_020098183.1| rho guanine nucleotide exchange factor 8-like isoform X1 [Ananas comosus] gb|OAY83007.1| Rho guanine nucleotide exchange factor 8 [Ananas comosus] Length = 527 Score = 58.9 bits (141), Expect = 3e-07 Identities = 24/42 (57%), Positives = 33/42 (78%) Frame = +1 Query: 19 MKEDSNKRWRKEVDWLLSVTDHIV*FVPVQHTARDRSNLEVI 144 M + +RWRKE+DWLLSVTDHIV FVP Q ++D +N+E++ Sbjct: 143 MSAERKQRWRKEIDWLLSVTDHIVEFVPSQQVSKDGTNMEIM 184 >ref|XP_021996617.1| rho guanine nucleotide exchange factor 8-like [Helianthus annuus] Length = 469 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = +1 Query: 19 MKEDSNKRWRKEVDWLLSVTDHIV*FVPVQHTARDRSNLEVI 144 M ED +RWR+EV WLLSVT++IV FVP Q T++D SN+EV+ Sbjct: 78 MPEDRKRRWRREVGWLLSVTNYIVEFVPSQQTSKDGSNMEVM 119 >ref|XP_006465619.1| PREDICTED: rop guanine nucleotide exchange factor 12 [Citrus sinensis] gb|KDO56914.1| hypothetical protein CISIN_1g047173mg [Citrus sinensis] dbj|GAY51150.1| hypothetical protein CUMW_132110 [Citrus unshiu] Length = 557 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/42 (57%), Positives = 33/42 (78%) Frame = +1 Query: 19 MKEDSNKRWRKEVDWLLSVTDHIV*FVPVQHTARDRSNLEVI 144 M ++ RWRKE+DWLLSVTDHIV FVP Q ++D +N+E++ Sbjct: 150 MSAETKARWRKEIDWLLSVTDHIVEFVPSQQKSKDGTNMEIM 191 >ref|XP_006426954.1| rop guanine nucleotide exchange factor 12 [Citrus clementina] gb|ESR40194.1| hypothetical protein CICLE_v10027341mg [Citrus clementina] Length = 557 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/42 (57%), Positives = 33/42 (78%) Frame = +1 Query: 19 MKEDSNKRWRKEVDWLLSVTDHIV*FVPVQHTARDRSNLEVI 144 M ++ RWRKE+DWLLSVTDHIV FVP Q ++D +N+E++ Sbjct: 150 MSAETKARWRKEIDWLLSVTDHIVEFVPSQQKSKDGTNMEIM 191 >gb|PNX87215.1| rho guanine nucleotide exchange factor 8-like protein, partial [Trifolium pratense] Length = 157 Score = 56.2 bits (134), Expect = 6e-07 Identities = 23/42 (54%), Positives = 31/42 (73%) Frame = +1 Query: 19 MKEDSNKRWRKEVDWLLSVTDHIV*FVPVQHTARDRSNLEVI 144 M ++ RWR+E+DWLLSVTDHIV F P Q A+D S +E++ Sbjct: 1 MSQERKARWRREIDWLLSVTDHIVEFAPSQQIAKDGSTMEIM 42 >ref|XP_022559434.1| rop guanine nucleotide exchange factor 13-like [Brassica napus] Length = 534 Score = 58.2 bits (139), Expect = 6e-07 Identities = 27/54 (50%), Positives = 36/54 (66%) Frame = +1 Query: 19 MKEDSNKRWRKEVDWLLSVTDHIV*FVPVQHTARDRSNLEVIYLPSC*DMVPKL 180 M ED +RWR+E+ WLLSVTDHIV F P Q T +D S++EV+ D+V + Sbjct: 138 MSEDRKERWRREIGWLLSVTDHIVEFSPTQQTNKDGSSIEVMTTRQRTDLVSNI 191 >emb|CDY30136.1| BnaC05g37260D [Brassica napus] Length = 550 Score = 58.2 bits (139), Expect = 6e-07 Identities = 27/54 (50%), Positives = 36/54 (66%) Frame = +1 Query: 19 MKEDSNKRWRKEVDWLLSVTDHIV*FVPVQHTARDRSNLEVIYLPSC*DMVPKL 180 M ED +RWR+E+ WLLSVTDHIV F P Q T +D S++EV+ D+V + Sbjct: 154 MSEDRKERWRREIGWLLSVTDHIVEFSPTQQTNKDGSSIEVMTTRQRTDLVSNI 207 >ref|XP_013637993.1| PREDICTED: LOW QUALITY PROTEIN: rop guanine nucleotide exchange factor 13-like [Brassica oleracea var. oleracea] Length = 581 Score = 58.2 bits (139), Expect = 6e-07 Identities = 27/54 (50%), Positives = 36/54 (66%) Frame = +1 Query: 19 MKEDSNKRWRKEVDWLLSVTDHIV*FVPVQHTARDRSNLEVIYLPSC*DMVPKL 180 M ED +RWR+E+ WLLSVTDHIV F P Q T +D S++EV+ D+V + Sbjct: 182 MSEDRKERWRREIGWLLSVTDHIVEFSPTQQTNKDGSSIEVMTTRQRTDLVSNI 235 >gb|OAP05137.1| ROPGEF13 [Arabidopsis thaliana] Length = 220 Score = 57.0 bits (136), Expect = 7e-07 Identities = 30/70 (42%), Positives = 41/70 (58%), Gaps = 2/70 (2%) Frame = +1 Query: 19 MKEDSNKRWRKEVDWLLSVTDHIV*FVPVQHTARDRSNLEVIYLPSC*DMVPKL--LNIV 192 + ED +RWR+E+ WLLSVTDHIV F P T D S++EV+ D+V + L + Sbjct: 149 ISEDKKERWRREIGWLLSVTDHIVEFSPTHQTNEDGSSMEVMTTKQRTDLVSNIPSLKKL 208 Query: 193 TERLHIKANK 222 E L + NK Sbjct: 209 DEMLLVSQNK 218