BLASTX nr result
ID: Chrysanthemum21_contig00029127
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00029127 (920 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGZ84811.1| germacrene D synthase [Achillea millefolium] 86 4e-15 emb|CAC36896.1| germacrene A synthase [Solidago canadensis] 76 1e-11 emb|CAE47440.1| germacrene D synthase [Solidago canadensis] 75 2e-11 gb|AAR31145.1| (-)-germacrene D synthase [Solidago canadensis] 74 4e-11 gb|PIM97320.1| Bicyclogermacrene synthase [Handroanthus impetigi... 72 1e-10 gb|OTF85116.1| putative isoprenoid synthase domain-containing pr... 69 2e-10 gb|PIN22715.1| Bicyclogermacrene synthase [Handroanthus impetigi... 72 3e-10 ref|XP_023768568.1| beta-caryophyllene synthase-like [Lactuca sa... 70 1e-09 ref|XP_022021315.1| (E)-beta-farnesene synthase-like isoform X3 ... 69 2e-09 ref|XP_022021314.1| (E)-beta-farnesene synthase-like isoform X2 ... 69 2e-09 gb|AEH41845.1| E-beta-caryophyllene synthase [Tanacetum parthenium] 69 2e-09 ref|XP_022021313.1| (E)-beta-farnesene synthase-like isoform X1 ... 69 2e-09 gb|AME16497.1| (Z)-gamma-bisabolene synthase K7 [Helianthus annuus] 69 2e-09 sp|I6QPS5.1|TPS5_MATCR RecName: Full=(-)-germacrene D synthase; ... 69 3e-09 gb|AIW00680.1| sesquiterpene cyclase [Matricaria chamomilla var.... 69 3e-09 emb|CAE47439.1| germacrene D synthase [Solidago canadensis] 69 4e-09 gb|AAR31144.1| (+)-germacrene D synthase [Solidago canadensis] 69 4e-09 ref|XP_020417878.1| (-)-alpha-pinene synthase-like [Prunus persica] 68 5e-09 ref|XP_004514757.1| PREDICTED: probable terpene synthase 2 [Cice... 68 5e-09 sp|J7LMP2.1|TPS5_PHYDL RecName: Full=Bicyclogermacrene synthase;... 68 5e-09 >gb|AGZ84811.1| germacrene D synthase [Achillea millefolium] Length = 548 Score = 86.3 bits (212), Expect = 4e-15 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +2 Query: 2 FTKAVERWSMTCMDTLPDYMKIIYKYLLNIYDELEETMEKKGKT 133 FTKAVERWSMTCMDTLPDYMK +YK LL+IYDELEETMEKKGKT Sbjct: 315 FTKAVERWSMTCMDTLPDYMKKMYKTLLDIYDELEETMEKKGKT 358 >emb|CAC36896.1| germacrene A synthase [Solidago canadensis] Length = 549 Score = 76.3 bits (186), Expect = 1e-11 Identities = 32/43 (74%), Positives = 40/43 (93%) Frame = +2 Query: 2 FTKAVERWSMTCMDTLPDYMKIIYKYLLNIYDELEETMEKKGK 130 FTKAV+RWS+TCMDTLPDYMK+IYK LL++Y+E+EE +EK GK Sbjct: 316 FTKAVQRWSITCMDTLPDYMKVIYKSLLDVYEEMEEIIEKDGK 358 >emb|CAE47440.1| germacrene D synthase [Solidago canadensis] Length = 551 Score = 75.5 bits (184), Expect = 2e-11 Identities = 32/43 (74%), Positives = 40/43 (93%) Frame = +2 Query: 2 FTKAVERWSMTCMDTLPDYMKIIYKYLLNIYDELEETMEKKGK 130 FTKAV+RWS+TCMDTLPDYMK+IYK LL++Y+E+EE +EK GK Sbjct: 318 FTKAVQRWSITCMDTLPDYMKMIYKSLLDVYEEMEEIIEKDGK 360 >gb|AAR31145.1| (-)-germacrene D synthase [Solidago canadensis] Length = 551 Score = 74.3 bits (181), Expect = 4e-11 Identities = 31/43 (72%), Positives = 40/43 (93%) Frame = +2 Query: 2 FTKAVERWSMTCMDTLPDYMKIIYKYLLNIYDELEETMEKKGK 130 FTKAV+RWS+TCMDTLPDYMK+IYK LL++Y+E+EE ++K GK Sbjct: 318 FTKAVQRWSITCMDTLPDYMKMIYKSLLDVYEEMEEIIDKDGK 360 >gb|PIM97320.1| Bicyclogermacrene synthase [Handroanthus impetiginosus] Length = 283 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/46 (65%), Positives = 39/46 (84%) Frame = +2 Query: 2 FTKAVERWSMTCMDTLPDYMKIIYKYLLNIYDELEETMEKKGKTQR 139 FT+A+ERWSM+C+D LPDYMKIIYK LL +Y+E+EE M K+G+ R Sbjct: 50 FTEAIERWSMSCLDQLPDYMKIIYKVLLEVYEEIEEEMIKQGRLYR 95 >gb|OTF85116.1| putative isoprenoid synthase domain-containing protein [Helianthus annuus] Length = 172 Score = 69.3 bits (168), Expect = 2e-10 Identities = 27/46 (58%), Positives = 39/46 (84%) Frame = +2 Query: 2 FTKAVERWSMTCMDTLPDYMKIIYKYLLNIYDELEETMEKKGKTQR 139 FTKA+++WS++CMD LP+YMK+IY+ +LN+Y E E+ +EKKG T R Sbjct: 77 FTKAIQKWSISCMDMLPEYMKLIYQEILNVYKEAEDLLEKKGNTYR 122 >gb|PIN22715.1| Bicyclogermacrene synthase [Handroanthus impetiginosus] Length = 536 Score = 71.6 bits (174), Expect = 3e-10 Identities = 30/46 (65%), Positives = 39/46 (84%) Frame = +2 Query: 2 FTKAVERWSMTCMDTLPDYMKIIYKYLLNIYDELEETMEKKGKTQR 139 FT+A+ERWSM+C+D LPDYMKIIYK LL +Y+E+EE M K+G+ R Sbjct: 294 FTEAIERWSMSCLDQLPDYMKIIYKVLLEVYEEIEEEMIKQGRLYR 339 >ref|XP_023768568.1| beta-caryophyllene synthase-like [Lactuca sativa] gb|PLY81830.1| hypothetical protein LSAT_3X23121 [Lactuca sativa] Length = 557 Score = 70.1 bits (170), Expect = 1e-09 Identities = 28/46 (60%), Positives = 40/46 (86%) Frame = +2 Query: 2 FTKAVERWSMTCMDTLPDYMKIIYKYLLNIYDELEETMEKKGKTQR 139 FT+A++RWSM+C+D LP+YMK+IYK LL++Y E E+ +EKKG+T R Sbjct: 325 FTEAIQRWSMSCLDMLPEYMKLIYKELLDVYKEAEDLLEKKGQTYR 370 >ref|XP_022021315.1| (E)-beta-farnesene synthase-like isoform X3 [Helianthus annuus] Length = 491 Score = 69.3 bits (168), Expect = 2e-09 Identities = 27/46 (58%), Positives = 39/46 (84%) Frame = +2 Query: 2 FTKAVERWSMTCMDTLPDYMKIIYKYLLNIYDELEETMEKKGKTQR 139 FTKA+++WS++CMD LP+YMK+IY+ +LN+Y E E+ +EKKG T R Sbjct: 259 FTKAIQKWSISCMDMLPEYMKLIYQEILNVYKEAEDLLEKKGNTYR 304 >ref|XP_022021314.1| (E)-beta-farnesene synthase-like isoform X2 [Helianthus annuus] Length = 539 Score = 69.3 bits (168), Expect = 2e-09 Identities = 27/46 (58%), Positives = 39/46 (84%) Frame = +2 Query: 2 FTKAVERWSMTCMDTLPDYMKIIYKYLLNIYDELEETMEKKGKTQR 139 FTKA+++WS++CMD LP+YMK+IY+ +LN+Y E E+ +EKKG T R Sbjct: 307 FTKAIQKWSISCMDMLPEYMKLIYQEILNVYKEAEDLLEKKGNTYR 352 >gb|AEH41845.1| E-beta-caryophyllene synthase [Tanacetum parthenium] Length = 548 Score = 69.3 bits (168), Expect = 2e-09 Identities = 28/43 (65%), Positives = 39/43 (90%) Frame = +2 Query: 2 FTKAVERWSMTCMDTLPDYMKIIYKYLLNIYDELEETMEKKGK 130 FT+A++RWS+TC+DTLP+YMK++YK +LNIY E+EE M K+GK Sbjct: 316 FTEAIQRWSITCIDTLPEYMKLLYKGVLNIYKEMEEIMGKEGK 358 >ref|XP_022021313.1| (E)-beta-farnesene synthase-like isoform X1 [Helianthus annuus] gb|OTF85115.1| putative terpenoid cyclases/protein prenyltransferase alpha-alpha toroid [Helianthus annuus] Length = 563 Score = 69.3 bits (168), Expect = 2e-09 Identities = 27/46 (58%), Positives = 39/46 (84%) Frame = +2 Query: 2 FTKAVERWSMTCMDTLPDYMKIIYKYLLNIYDELEETMEKKGKTQR 139 FTKA+++WS++CMD LP+YMK+IY+ +LN+Y E E+ +EKKG T R Sbjct: 331 FTKAIQKWSISCMDMLPEYMKLIYQEILNVYKEAEDLLEKKGNTYR 376 >gb|AME16497.1| (Z)-gamma-bisabolene synthase K7 [Helianthus annuus] Length = 565 Score = 69.3 bits (168), Expect = 2e-09 Identities = 27/46 (58%), Positives = 39/46 (84%) Frame = +2 Query: 2 FTKAVERWSMTCMDTLPDYMKIIYKYLLNIYDELEETMEKKGKTQR 139 FTKA+++WS++CMD LP+YMK+IY+ +LN+Y E E+ +EKKG T R Sbjct: 333 FTKAIQKWSISCMDMLPEYMKLIYQEILNVYKEAEDLLEKKGNTYR 378 >sp|I6QPS5.1|TPS5_MATCR RecName: Full=(-)-germacrene D synthase; AltName: Full=Terpene synthase 5 gb|AFM43738.1| terpene synthase 5 [Matricaria chamomilla var. recutita] Length = 549 Score = 68.9 bits (167), Expect = 3e-09 Identities = 27/42 (64%), Positives = 39/42 (92%) Frame = +2 Query: 2 FTKAVERWSMTCMDTLPDYMKIIYKYLLNIYDELEETMEKKG 127 FT+AVERWS+TC+D LP+YMK+IYK LL++Y+E+++TM K+G Sbjct: 315 FTQAVERWSLTCLDALPEYMKLIYKELLDLYEEMDDTMAKEG 356 >gb|AIW00680.1| sesquiterpene cyclase [Matricaria chamomilla var. recutita] Length = 573 Score = 68.9 bits (167), Expect = 3e-09 Identities = 26/44 (59%), Positives = 42/44 (95%) Frame = +2 Query: 2 FTKAVERWSMTCMDTLPDYMKIIYKYLLNIYDELEETMEKKGKT 133 FT+AV+RWS++C+D+LP+YMK+IY+ L+N+Y E+EE++EK+GK+ Sbjct: 342 FTEAVQRWSLSCLDSLPEYMKLIYQELINLYHEMEESVEKEGKS 385 >emb|CAE47439.1| germacrene D synthase [Solidago canadensis] Length = 551 Score = 68.6 bits (166), Expect = 4e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +2 Query: 2 FTKAVERWSMTCMDTLPDYMKIIYKYLLNIYDELEETMEKKGK 130 FTKA++ WS TCMDT PDYMK+IYK LL+IY+E+EE MEK GK Sbjct: 318 FTKALQTWS-TCMDTFPDYMKVIYKSLLDIYEEMEEIMEKNGK 359 >gb|AAR31144.1| (+)-germacrene D synthase [Solidago canadensis] Length = 551 Score = 68.6 bits (166), Expect = 4e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +2 Query: 2 FTKAVERWSMTCMDTLPDYMKIIYKYLLNIYDELEETMEKKGK 130 FTKA++ WS TCMDT PDYMK+IYK LL+IY+E+EE MEK GK Sbjct: 318 FTKALQTWS-TCMDTFPDYMKVIYKSLLDIYEEMEEIMEKNGK 359 >ref|XP_020417878.1| (-)-alpha-pinene synthase-like [Prunus persica] Length = 518 Score = 68.2 bits (165), Expect = 5e-09 Identities = 27/46 (58%), Positives = 37/46 (80%) Frame = +2 Query: 2 FTKAVERWSMTCMDTLPDYMKIIYKYLLNIYDELEETMEKKGKTQR 139 FT A+ERW + CMD LPDYM++ Y+ LLN+YDE+EE M K+G++ R Sbjct: 286 FTGAIERWDINCMDELPDYMQVFYRTLLNVYDEIEEEMVKEGRSYR 331 >ref|XP_004514757.1| PREDICTED: probable terpene synthase 2 [Cicer arietinum] Length = 556 Score = 68.2 bits (165), Expect = 5e-09 Identities = 27/43 (62%), Positives = 38/43 (88%) Frame = +2 Query: 2 FTKAVERWSMTCMDTLPDYMKIIYKYLLNIYDELEETMEKKGK 130 FTKAVERW ++C+D LP+YMKI+YK LLN+YDE+E+ +K+G+ Sbjct: 324 FTKAVERWDISCLDDLPNYMKILYKSLLNVYDEIEQETKKEGR 366 >sp|J7LMP2.1|TPS5_PHYDL RecName: Full=Bicyclogermacrene synthase; AltName: Full=Terpene synthase 5; Short=LdTPS5 gb|AFR23369.1| bicyclogermacrene synthase [Phyla dulcis] Length = 565 Score = 68.2 bits (165), Expect = 5e-09 Identities = 28/46 (60%), Positives = 39/46 (84%) Frame = +2 Query: 2 FTKAVERWSMTCMDTLPDYMKIIYKYLLNIYDELEETMEKKGKTQR 139 FT+A+ERWS++C+D LPDYMK+IYK +L +YDE+EE M K+G + R Sbjct: 332 FTQALERWSISCLDQLPDYMKLIYKTVLEVYDEIEEEMIKQGTSYR 377