BLASTX nr result
ID: Chrysanthemum21_contig00029022
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00029022 (401 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021968850.1| mavicyanin-like [Helianthus annuus] >gi|1191... 71 6e-13 gb|PRQ17934.1| putative Blue (type 1) copper binding protein [Ro... 56 9e-07 ref|XP_021604698.1| basic blue protein-like [Manihot esculenta] ... 53 6e-06 >ref|XP_021968850.1| mavicyanin-like [Helianthus annuus] gb|OTG23040.1| putative cupredoxin [Helianthus annuus] Length = 134 Score = 70.9 bits (172), Expect = 6e-13 Identities = 31/48 (64%), Positives = 36/48 (75%) Frame = -2 Query: 400 PPGAKPLTSGDDLIAIKAPGKRYFICSVKDGHHCRDGKMKFFIDIPPP 257 PP AKPLTSG D+I I APGKR+FIC K+G HC+DG MK I+I P Sbjct: 77 PPSAKPLTSGKDVIKIDAPGKRWFICGFKNGKHCKDGGMKLMINIQKP 124 >gb|PRQ17934.1| putative Blue (type 1) copper binding protein [Rosa chinensis] Length = 195 Score = 55.8 bits (133), Expect = 9e-07 Identities = 29/59 (49%), Positives = 39/59 (66%) Frame = -2 Query: 400 PPGAKPLTSGDDLIAIKAPGKRYFICSVKDGHHCRDGKMKFFIDIPPPYESSADSTGST 224 P K LTSG+D+I + APGK+YFIC+V G HC+ G K I++ ESS+ S+ ST Sbjct: 79 PADGKELTSGEDVIKLDAPGKKYFICNV--GRHCQMGNQKVAINV----ESSSSSSSST 131 >ref|XP_021604698.1| basic blue protein-like [Manihot esculenta] gb|OAY59919.1| hypothetical protein MANES_01G071000 [Manihot esculenta] Length = 168 Score = 53.1 bits (126), Expect = 6e-06 Identities = 26/74 (35%), Positives = 43/74 (58%), Gaps = 11/74 (14%) Frame = -2 Query: 400 PPGAKPLTSGDDLIAIKAPGKRYFICSVKDGHHCRDGKMKFFIDI-----------PPPY 254 P G + LT+G+D + + +PGK+++ICS+ G+HC+ G M+ I + P Sbjct: 79 PAGTEALTTGEDTLTLTSPGKKWYICSM--GNHCKSGNMRLTITVLAELGSPTASPSPSP 136 Query: 253 ESSADSTGSTGIQG 212 S+A +TG TG+ G Sbjct: 137 VSAAVATGRTGLSG 150