BLASTX nr result
ID: Chrysanthemum21_contig00029006
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00029006 (639 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022020539.1| mediator of RNA polymerase II transcription ... 60 9e-07 >ref|XP_022020539.1| mediator of RNA polymerase II transcription subunit 23-like [Helianthus annuus] gb|OTF87867.1| putative mediator complex, subunit Med23 [Helianthus annuus] Length = 1550 Score = 59.7 bits (143), Expect = 9e-07 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +1 Query: 10 YAEASRVIEDNKLNSAVGFALLDPTWAAQENTSTTLGFV 126 Y EASRVI+DN+ +S V +ALLDPTWAAQ+NTST LG V Sbjct: 1356 YEEASRVIKDNESHSVVAYALLDPTWAAQDNTSTALGNV 1394