BLASTX nr result
ID: Chrysanthemum21_contig00028965
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00028965 (726 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022036118.1| dnaJ homolog subfamily C member 7-like [Heli... 151 2e-38 gb|KVI12103.1| DnaJ domain-containing protein, partial [Cynara c... 141 7e-35 ref|XP_023739896.1| dnaJ homolog subfamily C member 7-like [Lact... 127 8e-30 gb|ESQ27269.1| hypothetical protein EUTSA_v10019440mg, partial [... 66 5e-09 ref|XP_006389983.2| interactor of constitutive active ROPs 4 [Eu... 66 5e-09 ref|XP_010537680.1| PREDICTED: interactor of constitutive active... 65 2e-08 ref|NP_177964.2| ROP interactive partner 2 [Arabidopsis thaliana... 62 1e-07 gb|AAF71812.1|AC013430_21 F3F9.6 [Arabidopsis thaliana] 62 1e-07 ref|XP_010472061.1| PREDICTED: interactor of constitutive active... 62 1e-07 ref|XP_010416825.1| PREDICTED: interactor of constitutive active... 62 1e-07 ref|XP_010428969.1| PREDICTED: interactor of constitutive active... 61 3e-07 ref|XP_018825164.1| PREDICTED: interactor of constitutive active... 61 3e-07 ref|XP_002887737.1| interactor of constitutive active ROPs 4 [Ar... 60 5e-07 ref|XP_009110425.1| PREDICTED: interactor of constitutive active... 60 9e-07 ref|XP_006302546.1| interactor of constitutive active ROPs 4 [Ca... 60 9e-07 ref|XP_023645140.1| interactor of constitutive active ROPs 1 [Ca... 59 1e-06 ref|XP_008226246.1| PREDICTED: interactor of constitutive active... 59 1e-06 ref|XP_018442687.1| PREDICTED: interactor of constitutive active... 58 4e-06 ref|XP_013600843.1| PREDICTED: interactor of constitutive active... 58 4e-06 ref|XP_018450954.1| PREDICTED: interactor of constitutive active... 58 4e-06 >ref|XP_022036118.1| dnaJ homolog subfamily C member 7-like [Helianthus annuus] gb|OTG29688.1| putative dnaJ domain, Zinc finger, CCHC-type, Tetratricopeptide-like helical domain protein [Helianthus annuus] Length = 745 Score = 151 bits (382), Expect = 2e-38 Identities = 81/136 (59%), Positives = 102/136 (75%), Gaps = 3/136 (2%) Frame = +3 Query: 324 EQQLEKCTKELSSLKDKDEAWVKKVRALNKEFAETKHELNEKIKHLE---EANETANDEI 494 ++ LEK +E+S+L++KD+ ++ ALN E ETK ELNEKI+ LE EANE+A EI Sbjct: 188 QEDLEKSREEISNLREKDDEMYRRWCALNNELEETKGELNEKIEELEDANEANESAVLEI 247 Query: 495 LMQKLETEKWRKTAKAIVSVLVGNAELCSKTSELESLVLYYTNRAAKRMSLKKFGKAMDD 674 + ++ E WRK AKAI SVLV A++CSKTSELE LVLYY+NRAAKRMSL KF KA+DD Sbjct: 248 TRKTMDVEHWRKAAKAITSVLVAGADICSKTSELEFLVLYYSNRAAKRMSLGKFRKALDD 307 Query: 675 CRMATYLDPGCLKVRL 722 C++AT LDP LKV L Sbjct: 308 CKVATRLDPSFLKVFL 323 >gb|KVI12103.1| DnaJ domain-containing protein, partial [Cynara cardunculus var. scolymus] Length = 644 Score = 141 bits (355), Expect = 7e-35 Identities = 79/144 (54%), Positives = 97/144 (67%), Gaps = 11/144 (7%) Frame = +3 Query: 315 SSLEQQLEKCTKELSSLKDKDEAWVKKVRALNKEFAETKHELNEKIKHLEEAN------- 473 S L++ LEK ++LSS ++K+ +K + EF ETK EL EKI LEE Sbjct: 106 SKLQKDLEKYRQDLSSARNKEAEMSRKCWHMKNEFEETKDELYEKITELEECKDRMYEKI 165 Query: 474 ----ETANDEILMQKLETEKWRKTAKAIVSVLVGNAELCSKTSELESLVLYYTNRAAKRM 641 ET + E++ KLETE+WRK AKAI SVL G AE+CSKT ELESLVLYY+NRAAKRM Sbjct: 166 TELEETNDAEMMKLKLETEQWRKAAKAIASVLGGGAEVCSKTPELESLVLYYSNRAAKRM 225 Query: 642 SLKKFGKAMDDCRMATYLDPGCLK 713 SL K KA++DCRMAT LDP L+ Sbjct: 226 SLGKMRKAVNDCRMATLLDPSFLR 249 >ref|XP_023739896.1| dnaJ homolog subfamily C member 7-like [Lactuca sativa] gb|PLY69108.1| hypothetical protein LSAT_8X83340 [Lactuca sativa] Length = 722 Score = 127 bits (319), Expect = 8e-30 Identities = 74/136 (54%), Positives = 90/136 (66%) Frame = +3 Query: 315 SSLEQQLEKCTKELSSLKDKDEAWVKKVRALNKEFAETKHELNEKIKHLEEANETANDEI 494 + L+ LEKC ELSS + K EA + ++ + K K + LEEANETA+ E+ Sbjct: 184 NKLKDDLEKCRNELSSARKK-EAEISRMYLVMKN----------KFEELEEANETADAEM 232 Query: 495 LMQKLETEKWRKTAKAIVSVLVGNAELCSKTSELESLVLYYTNRAAKRMSLKKFGKAMDD 674 K+ETE+WRK AKAI SVL G L SKT ELESLVLYY+NRA+KRMSL K KA+DD Sbjct: 233 KQMKVETEQWRKAAKAIASVLDGGEVLSSKTQELESLVLYYSNRASKRMSLGKMRKAVDD 292 Query: 675 CRMATYLDPGCLKVRL 722 CR+A LDP LKV L Sbjct: 293 CRIAARLDPSYLKVCL 308 >gb|ESQ27269.1| hypothetical protein EUTSA_v10019440mg, partial [Eutrema salsugineum] Length = 321 Score = 66.2 bits (160), Expect = 5e-09 Identities = 37/95 (38%), Positives = 56/95 (58%), Gaps = 3/95 (3%) Frame = +3 Query: 318 SLEQQLEKCTKELSSLKDKDEAWVKKVRALNKEFAETKHE---LNEKIKHLEEANETAND 488 SL QL+K E+SS+K K++ KV + +E E+ E L +K++ +EEA E+ Sbjct: 177 SLRNQLKKTDSEMSSVKAKEDEIASKVNQIGEELEESNEETAKLKKKLESVEEAKESLET 236 Query: 489 EILMQKLETEKWRKTAKAIVSVLVGNAELCSKTSE 593 E+ K+ TE+WRK A A +VL G E+ S+ SE Sbjct: 237 EMKKLKVLTEQWRKAADAAAAVLSGGVEMNSRFSE 271 >ref|XP_006389983.2| interactor of constitutive active ROPs 4 [Eutrema salsugineum] Length = 325 Score = 66.2 bits (160), Expect = 5e-09 Identities = 37/95 (38%), Positives = 56/95 (58%), Gaps = 3/95 (3%) Frame = +3 Query: 318 SLEQQLEKCTKELSSLKDKDEAWVKKVRALNKEFAETKHE---LNEKIKHLEEANETAND 488 SL QL+K E+SS+K K++ KV + +E E+ E L +K++ +EEA E+ Sbjct: 181 SLRNQLKKTDSEMSSVKAKEDEIASKVNQIGEELEESNEETAKLKKKLESVEEAKESLET 240 Query: 489 EILMQKLETEKWRKTAKAIVSVLVGNAELCSKTSE 593 E+ K+ TE+WRK A A +VL G E+ S+ SE Sbjct: 241 EMKKLKVLTEQWRKAADAAAAVLSGGVEMNSRFSE 275 >ref|XP_010537680.1| PREDICTED: interactor of constitutive active ROPs 4-like [Tarenaya hassleriana] ref|XP_010537681.1| PREDICTED: interactor of constitutive active ROPs 4-like [Tarenaya hassleriana] ref|XP_010537682.1| PREDICTED: interactor of constitutive active ROPs 4-like [Tarenaya hassleriana] Length = 355 Score = 64.7 bits (156), Expect = 2e-08 Identities = 34/94 (36%), Positives = 53/94 (56%), Gaps = 3/94 (3%) Frame = +3 Query: 321 LEQQLEKCTKELSSLKDKDEAWVKKVRALNKEFAETKH---ELNEKIKHLEEANETANDE 491 L+ QL E+S++K K+E K+ + KE ET+ +L EK++ EEA E E Sbjct: 206 LKNQLNDTASEMSNVKAKEEEMASKMNQIGKELEETQANAAQLKEKLESTEEAKEELETE 265 Query: 492 ILMQKLETEKWRKTAKAIVSVLVGNAELCSKTSE 593 + +++TE+WRK A A +VL G E+ + SE Sbjct: 266 MKKLRVQTEQWRKAADAAAAVLAGGVEMNGRVSE 299 >ref|NP_177964.2| ROP interactive partner 2 [Arabidopsis thaliana] sp|Q9M9F9.2|ICR4_ARATH RecName: Full=Interactor of constitutive active ROPs 4; AltName: Full=ROP-interactive partner 4 gb|AEE36105.1| ROP interactive partner 2 [Arabidopsis thaliana] gb|OAP14720.1| RIP4 [Arabidopsis thaliana] Length = 324 Score = 62.4 bits (150), Expect = 1e-07 Identities = 35/95 (36%), Positives = 55/95 (57%), Gaps = 3/95 (3%) Frame = +3 Query: 318 SLEQQLEKCTKELSSLKDKDEAWVKKVRALNKEFAE---TKHELNEKIKHLEEANETAND 488 +L+ QL+K E+S K K++ KV + +E E T +L +K++ +EEA ET Sbjct: 182 TLKDQLKKTDTEMSCAKAKEDEIASKVSQIGEELEESNETTAKLKKKLESVEEAKETLEA 241 Query: 489 EILMQKLETEKWRKTAKAIVSVLVGNAELCSKTSE 593 E+ K++TE+WRK A A +VL G E+ + SE Sbjct: 242 EMKKLKVQTEQWRKAADAAAAVLSGGVEMNGRFSE 276 >gb|AAF71812.1|AC013430_21 F3F9.6 [Arabidopsis thaliana] Length = 326 Score = 62.4 bits (150), Expect = 1e-07 Identities = 35/95 (36%), Positives = 55/95 (57%), Gaps = 3/95 (3%) Frame = +3 Query: 318 SLEQQLEKCTKELSSLKDKDEAWVKKVRALNKEFAE---TKHELNEKIKHLEEANETAND 488 +L+ QL+K E+S K K++ KV + +E E T +L +K++ +EEA ET Sbjct: 184 TLKDQLKKTDTEMSCAKAKEDEIASKVSQIGEELEESNETTAKLKKKLESVEEAKETLEA 243 Query: 489 EILMQKLETEKWRKTAKAIVSVLVGNAELCSKTSE 593 E+ K++TE+WRK A A +VL G E+ + SE Sbjct: 244 EMKKLKVQTEQWRKAADAAAAVLSGGVEMNGRFSE 278 >ref|XP_010472061.1| PREDICTED: interactor of constitutive active ROPs 4 [Camelina sativa] ref|XP_010472062.1| PREDICTED: interactor of constitutive active ROPs 4 [Camelina sativa] Length = 327 Score = 62.4 bits (150), Expect = 1e-07 Identities = 34/96 (35%), Positives = 57/96 (59%), Gaps = 3/96 (3%) Frame = +3 Query: 315 SSLEQQLEKCTKELSSLKDKDEAWVKKVRALNKEFAE---TKHELNEKIKHLEEANETAN 485 +SL+ QL++ E+S+ K K++ KV + +E E T EL +K++ +E+A E+ Sbjct: 182 ASLKDQLKRTGSEMSTAKAKEDEIASKVSQIEEELEESNETTAELKKKLESMEDAKESLE 241 Query: 486 DEILMQKLETEKWRKTAKAIVSVLVGNAELCSKTSE 593 E+ K++TE+WRK A A +VL G E+ + SE Sbjct: 242 VEMKKLKVQTEQWRKAADAAAAVLSGGVEMNGRFSE 277 >ref|XP_010416825.1| PREDICTED: interactor of constitutive active ROPs 4 [Camelina sativa] Length = 327 Score = 62.4 bits (150), Expect = 1e-07 Identities = 34/96 (35%), Positives = 57/96 (59%), Gaps = 3/96 (3%) Frame = +3 Query: 315 SSLEQQLEKCTKELSSLKDKDEAWVKKVRALNKEFAE---TKHELNEKIKHLEEANETAN 485 +SL+ QL++ E+S+ K K++ KV + +E E T EL +K++ +E+A E+ Sbjct: 182 ASLKDQLKRTGSEMSTAKVKEDEIASKVSQIKEELEESNETTAELKKKLESMEDAKESLE 241 Query: 486 DEILMQKLETEKWRKTAKAIVSVLVGNAELCSKTSE 593 E+ K++TE+WRK A A +VL G E+ + SE Sbjct: 242 AEMKKLKVQTEQWRKAADAAAAVLSGGVEMNGRFSE 277 >ref|XP_010428969.1| PREDICTED: interactor of constitutive active ROPs 4-like [Camelina sativa] ref|XP_010428970.1| PREDICTED: interactor of constitutive active ROPs 4-like [Camelina sativa] ref|XP_010428971.1| PREDICTED: interactor of constitutive active ROPs 4-like [Camelina sativa] Length = 328 Score = 61.2 bits (147), Expect = 3e-07 Identities = 33/96 (34%), Positives = 57/96 (59%), Gaps = 3/96 (3%) Frame = +3 Query: 315 SSLEQQLEKCTKELSSLKDKDEAWVKKVRALNKEFAE---TKHELNEKIKHLEEANETAN 485 +SL+ QL++ E+S+ K K++ KV + +E E T +L +K++ +E+A E+ Sbjct: 183 ASLKDQLKRTGSEMSTAKAKEDEIASKVSRIEEELEESNETTAKLKKKLESMEDAKESLE 242 Query: 486 DEILMQKLETEKWRKTAKAIVSVLVGNAELCSKTSE 593 E+ K++TE+WRK A A +VL G E+ + SE Sbjct: 243 AEMKKLKVQTEQWRKAADAAAAVLSGGVEMNGRFSE 278 >ref|XP_018825164.1| PREDICTED: interactor of constitutive active ROPs 4 [Juglans regia] ref|XP_018825165.1| PREDICTED: interactor of constitutive active ROPs 4 [Juglans regia] ref|XP_018825168.1| PREDICTED: interactor of constitutive active ROPs 4 [Juglans regia] Length = 382 Score = 61.2 bits (147), Expect = 3e-07 Identities = 34/93 (36%), Positives = 53/93 (56%), Gaps = 3/93 (3%) Frame = +3 Query: 321 LEQQLEKCTKELSSLKDKDEAWVKKVRALNKEFAETKH---ELNEKIKHLEEANETANDE 491 + QL + E+SS K K+ K+ L +E ++K +LNEK+K +EEA ET E Sbjct: 230 MRNQLSEAALEVSSSKTKEGETALKLSQLGEELKKSKANEAQLNEKLKAVEEAKETLELE 289 Query: 492 ILMQKLETEKWRKTAKAIVSVLVGNAELCSKTS 590 + +++TE+WRK A A +VL G E+ + S Sbjct: 290 MKKMRVQTEQWRKAADAAAAVLAGGVEMNGRIS 322 >ref|XP_002887737.1| interactor of constitutive active ROPs 4 [Arabidopsis lyrata subsp. lyrata] gb|EFH63996.1| hypothetical protein ARALYDRAFT_895740 [Arabidopsis lyrata subsp. lyrata] Length = 326 Score = 60.5 bits (145), Expect = 5e-07 Identities = 34/94 (36%), Positives = 54/94 (57%), Gaps = 3/94 (3%) Frame = +3 Query: 321 LEQQLEKCTKELSSLKDKDEAWVKKVRALNKEFAE---TKHELNEKIKHLEEANETANDE 491 L+ QL+K E+SS K K++ KV + +E E T +L +K++ +EEA E+ E Sbjct: 183 LKNQLKKTDSEMSSAKAKEDEIASKVSQIGEELEESNETTAKLKKKLESVEEAKESLEAE 242 Query: 492 ILMQKLETEKWRKTAKAIVSVLVGNAELCSKTSE 593 + K++TE+WRK A A +VL E+ + SE Sbjct: 243 MKKLKVQTEQWRKAADAAAAVLAEGVEMNGRFSE 276 >ref|XP_009110425.1| PREDICTED: interactor of constitutive active ROPs 1-like [Brassica rapa] Length = 324 Score = 59.7 bits (143), Expect = 9e-07 Identities = 30/89 (33%), Positives = 52/89 (58%), Gaps = 3/89 (3%) Frame = +3 Query: 318 SLEQQLEKCTKELSSLKDKDEAWVKKVRALNKEFAETKHE---LNEKIKHLEEANETAND 488 SL+ QL E+S+++ K++ KV + +E E++ + L EK++ +EEA E Sbjct: 187 SLKNQLTDSASEMSNVRAKEDEMASKVSQIGEELEESRADTAQLKEKLESMEEAKEALES 246 Query: 489 EILMQKLETEKWRKTAKAIVSVLVGNAEL 575 E+ +++TE+WRK A A +VL G E+ Sbjct: 247 EMKKLRVQTEQWRKAADAAAAVLSGETEM 275 >ref|XP_006302546.1| interactor of constitutive active ROPs 4 [Capsella rubella] ref|XP_023643605.1| interactor of constitutive active ROPs 4 [Capsella rubella] ref|XP_023643606.1| interactor of constitutive active ROPs 4 [Capsella rubella] ref|XP_023643607.1| interactor of constitutive active ROPs 4 [Capsella rubella] ref|XP_023643608.1| interactor of constitutive active ROPs 4 [Capsella rubella] gb|EOA35444.1| hypothetical protein CARUB_v10020647mg [Capsella rubella] Length = 326 Score = 59.7 bits (143), Expect = 9e-07 Identities = 33/94 (35%), Positives = 54/94 (57%), Gaps = 3/94 (3%) Frame = +3 Query: 321 LEQQLEKCTKELSSLKDKDEAWVKKVRALNKEFAE---TKHELNEKIKHLEEANETANDE 491 L+ QL+K E+S+ K K+ KV + +E E T +L +K++ +EEA E+ E Sbjct: 183 LKNQLKKMDSEMSTAKAKEGGIASKVSQIEEELQESNETMAKLKKKLESMEEAKESLEAE 242 Query: 492 ILMQKLETEKWRKTAKAIVSVLVGNAELCSKTSE 593 + +++TE+WRK A A +VL G E+ + SE Sbjct: 243 MKKLRVQTEQWRKAADAAAAVLSGGVEMNGRFSE 276 >ref|XP_023645140.1| interactor of constitutive active ROPs 1 [Capsella rubella] gb|EOA38153.1| hypothetical protein CARUB_v10009626mg [Capsella rubella] Length = 344 Score = 59.3 bits (142), Expect = 1e-06 Identities = 31/89 (34%), Positives = 52/89 (58%), Gaps = 3/89 (3%) Frame = +3 Query: 318 SLEQQLEKCTKELSSLKDKDEAWVKKVRALNKEFAETKHE---LNEKIKHLEEANETAND 488 SL+ QL ELS++K ++ KV + +E E++ + L EK++ +EEA +T Sbjct: 193 SLKNQLSDSASELSNVKANEDVMASKVSRIGEELEESRAKTAHLKEKLESMEEAKDTLEA 252 Query: 489 EILMQKLETEKWRKTAKAIVSVLVGNAEL 575 E+ +++TE+WRK A A +VL G E+ Sbjct: 253 EMKKLRVQTEQWRKAADAAAAVLSGEFEM 281 >ref|XP_008226246.1| PREDICTED: interactor of constitutive active ROPs 4-like [Prunus mume] Length = 381 Score = 59.3 bits (142), Expect = 1e-06 Identities = 33/94 (35%), Positives = 53/94 (56%), Gaps = 3/94 (3%) Frame = +3 Query: 321 LEQQLEKCTKELSSLKDKDEAWVKKVRALNKEFAETKH---ELNEKIKHLEEANETANDE 491 L+ QL + SS + KD+ K+ L +E +K +LNEK++ +E A ET + E Sbjct: 230 LKNQLNEAALNFSSAQAKDKEMTLKLSQLEQELEASKASAGQLNEKLQAMEGAKETMDAE 289 Query: 492 ILMQKLETEKWRKTAKAIVSVLVGNAELCSKTSE 593 + +++TE+WRK A A +VL G E+ + SE Sbjct: 290 MKKMRIQTEQWRKAADAAAAVLSGGMEMNGRISE 323 >ref|XP_018442687.1| PREDICTED: interactor of constitutive active ROPs 4 [Raphanus sativus] ref|XP_018442688.1| PREDICTED: interactor of constitutive active ROPs 4 [Raphanus sativus] Length = 323 Score = 57.8 bits (138), Expect = 4e-06 Identities = 32/95 (33%), Positives = 55/95 (57%), Gaps = 3/95 (3%) Frame = +3 Query: 318 SLEQQLEKCTKELSSLKDKDEAWVKKVRALNKEFAETKH---ELNEKIKHLEEANETAND 488 SL+ QL+K ++S K K++ KV + +E E+ +L ++++ +EEA E+ Sbjct: 176 SLKDQLKKTDSDMSCAKAKEDELALKVCQIREELEESNENTAQLKKQLETVEEAKESLEA 235 Query: 489 EILMQKLETEKWRKTAKAIVSVLVGNAELCSKTSE 593 E+ K++TE+WRK A A +VL G E+ + SE Sbjct: 236 EMEKLKVQTEQWRKAADAAAAVLSGGVEMNGRFSE 270 >ref|XP_013600843.1| PREDICTED: interactor of constitutive active ROPs 1-like [Brassica oleracea var. oleracea] ref|XP_013600844.1| PREDICTED: interactor of constitutive active ROPs 1-like [Brassica oleracea var. oleracea] ref|XP_013709907.1| interactor of constitutive active ROPs 1 [Brassica napus] ref|XP_013709908.1| interactor of constitutive active ROPs 1 [Brassica napus] Length = 323 Score = 57.8 bits (138), Expect = 4e-06 Identities = 30/88 (34%), Positives = 51/88 (57%), Gaps = 3/88 (3%) Frame = +3 Query: 321 LEQQLEKCTKELSSLKDKDEAWVKKVRALNKEFAETKHE---LNEKIKHLEEANETANDE 491 L+ QL E+S++K K+E KV + +E E++ + L EK++ +EEA + E Sbjct: 187 LKNQLTDSASEMSNVKAKEEETASKVSQIGEELEESRADTAQLKEKLESMEEAKKALEAE 246 Query: 492 ILMQKLETEKWRKTAKAIVSVLVGNAEL 575 + +++TE+WRK A A +VL G E+ Sbjct: 247 MKKLRVQTEQWRKAADAAAAVLSGETEM 274 >ref|XP_018450954.1| PREDICTED: interactor of constitutive active ROPs 1-like [Raphanus sativus] ref|XP_018450955.1| PREDICTED: interactor of constitutive active ROPs 1-like [Raphanus sativus] Length = 330 Score = 57.8 bits (138), Expect = 4e-06 Identities = 33/93 (35%), Positives = 52/93 (55%), Gaps = 4/93 (4%) Frame = +3 Query: 318 SLEQQLEKCTKELSSLKDKDEAWVKKVRALNKEF----AETKHELNEKIKHLEEANETAN 485 SL+ QL E+S +K ++ KV + +E A+T H L EK++ +EEA E Sbjct: 187 SLKNQLSDAASEMSKVKGNEDEMASKVSQIGEELEQSRAKTAH-LEEKLESMEEAKEALE 245 Query: 486 DEILMQKLETEKWRKTAKAIVSVLVGNAELCSK 584 E+ +++TE+WRK A A +VL G +E S+ Sbjct: 246 AEMKKLRVQTEQWRKAADAAAAVLSGESETNSQ 278