BLASTX nr result
ID: Chrysanthemum21_contig00028885
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00028885 (355 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021972843.1| probable serine/threonine-protein kinase WNK... 54 7e-06 >ref|XP_021972843.1| probable serine/threonine-protein kinase WNK4 [Helianthus annuus] gb|OTG20351.1| putative GPCR kinase [Helianthus annuus] Length = 455 Score = 53.9 bits (128), Expect = 7e-06 Identities = 41/102 (40%), Positives = 53/102 (51%), Gaps = 16/102 (15%) Frame = -2 Query: 354 LLKVKDPQAKEFIEKCLVYVSKRLLAKELLKIQSL-----------PLKVQLISHGRRLR 208 L KVKDPQ KEFIEKCLV S+RL AKELLK L P++V L ++ + Sbjct: 242 LSKVKDPQVKEFIEKCLVPASQRLPAKELLKDPFLAPESTKEHVHNPVEVNLSTYPMDID 301 Query: 207 TRCCLVDHV*RTTS--IPHYHLAKV---HNVWLKGKMAERTT 97 +V TTS +P L + + + LKG+M E T Sbjct: 302 DNFDMVSSTSNTTSTGLPLLELQSINARNEIRLKGEMNEENT 343