BLASTX nr result
ID: Chrysanthemum21_contig00028849
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00028849 (409 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022010636.1| BTB/POZ and MATH domain-containing protein 2... 70 2e-11 ref|XP_022869042.1| BTB/POZ and MATH domain-containing protein 2... 70 2e-11 gb|KVI03932.1| BTB/POZ-like protein [Cynara cardunculus var. sco... 69 4e-11 ref|XP_023738374.1| BTB/POZ and MATH domain-containing protein 2... 69 4e-11 gb|KVH94418.1| BTB/POZ-like protein [Cynara cardunculus var. sco... 69 4e-11 ref|XP_012092297.1| BTB/POZ and MATH domain-containing protein 2... 68 2e-10 ref|XP_021834088.1| BTB/POZ and MATH domain-containing protein 2... 68 2e-10 ref|XP_007201051.1| BTB/POZ and MATH domain-containing protein 2... 68 2e-10 ref|XP_022890576.1| BTB/POZ and MATH domain-containing protein 2... 68 2e-10 gb|PIN18183.1| Speckle-type POZ protein SPOP [Handroanthus impet... 68 2e-10 ref|XP_011082543.1| BTB/POZ and MATH domain-containing protein 2... 68 2e-10 ref|XP_011079801.1| BTB/POZ and MATH domain-containing protein 2... 68 2e-10 ref|XP_012832653.1| PREDICTED: BTB/POZ and MATH domain-containin... 68 2e-10 ref|XP_019240194.1| PREDICTED: BTB/POZ and MATH domain-containin... 68 2e-10 ref|XP_015088180.1| PREDICTED: BTB/POZ and MATH domain-containin... 68 2e-10 ref|XP_009599207.1| PREDICTED: BTB/POZ and MATH domain-containin... 68 2e-10 ref|XP_010326625.1| PREDICTED: BTB/POZ and MATH domain-containin... 68 2e-10 ref|XP_015578209.1| PREDICTED: BTB/POZ and MATH domain-containin... 68 2e-10 gb|EEF37654.1| Speckle-type POZ protein, putative [Ricinus commu... 68 2e-10 ref|XP_022040816.1| BTB/POZ and MATH domain-containing protein 2... 67 3e-10 >ref|XP_022010636.1| BTB/POZ and MATH domain-containing protein 2-like [Helianthus annuus] ref|XP_022010637.1| BTB/POZ and MATH domain-containing protein 2-like [Helianthus annuus] gb|OTF93921.1| putative TRAF-like, SKP1/BTB/POZ domain protein [Helianthus annuus] Length = 406 Score = 70.1 bits (170), Expect = 2e-11 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 306 VNGEHDFKISGYSLSKGIGIGKYIASDTFNVGGY 407 VNGEHDF+ISGYSLSKGIGIGKY+ASDTF VGGY Sbjct: 32 VNGEHDFRISGYSLSKGIGIGKYVASDTFTVGGY 65 >ref|XP_022869042.1| BTB/POZ and MATH domain-containing protein 2-like [Olea europaea var. sylvestris] Length = 410 Score = 70.1 bits (170), Expect = 2e-11 Identities = 38/66 (57%), Positives = 40/66 (60%), Gaps = 4/66 (6%) Frame = +3 Query: 222 MGRVNTDTGKXXXXXXXXXXXXXXXXXX----VNGEHDFKISGYSLSKGIGIGKYIASDT 389 MGRV T+T K VNG HDFKISGYSLSKGIGIGKY+ASDT Sbjct: 4 MGRVYTETAKPSSSTVMPVSPLVTTSTSLTETVNGSHDFKISGYSLSKGIGIGKYVASDT 63 Query: 390 FNVGGY 407 F VGGY Sbjct: 64 FTVGGY 69 >gb|KVI03932.1| BTB/POZ-like protein [Cynara cardunculus var. scolymus] Length = 397 Score = 69.3 bits (168), Expect = 4e-11 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 306 VNGEHDFKISGYSLSKGIGIGKYIASDTFNVGGY 407 VNGEHDF+ISGYSLSKGIGIGKY+ASDTF VGGY Sbjct: 33 VNGEHDFRISGYSLSKGIGIGKYVASDTFMVGGY 66 >ref|XP_023738374.1| BTB/POZ and MATH domain-containing protein 2-like [Lactuca sativa] gb|PLY70215.1| hypothetical protein LSAT_9X4501 [Lactuca sativa] Length = 405 Score = 69.3 bits (168), Expect = 4e-11 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 306 VNGEHDFKISGYSLSKGIGIGKYIASDTFNVGGY 407 VNGEHDF+ISGYSLSKGIGIGKY+ASDTF VGGY Sbjct: 31 VNGEHDFRISGYSLSKGIGIGKYVASDTFMVGGY 64 >gb|KVH94418.1| BTB/POZ-like protein [Cynara cardunculus var. scolymus] Length = 406 Score = 69.3 bits (168), Expect = 4e-11 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 306 VNGEHDFKISGYSLSKGIGIGKYIASDTFNVGGY 407 VNGEHDF+ISGYSLSKGIGIGKY+ASDTF VGGY Sbjct: 32 VNGEHDFRISGYSLSKGIGIGKYVASDTFMVGGY 65 >ref|XP_012092297.1| BTB/POZ and MATH domain-containing protein 2 [Jatropha curcas] gb|KDP21503.1| hypothetical protein JCGZ_21974 [Jatropha curcas] Length = 407 Score = 67.8 bits (164), Expect = 2e-10 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 306 VNGEHDFKISGYSLSKGIGIGKYIASDTFNVGGY 407 VNG H FKI+GYSLSKG+GIGKYIASDTFNVGGY Sbjct: 33 VNGSHQFKITGYSLSKGLGIGKYIASDTFNVGGY 66 >ref|XP_021834088.1| BTB/POZ and MATH domain-containing protein 2-like [Prunus avium] Length = 409 Score = 67.8 bits (164), Expect = 2e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 306 VNGEHDFKISGYSLSKGIGIGKYIASDTFNVGGY 407 VNG H FKI+GYSLSKGIGIGKYIASDTFNVGGY Sbjct: 35 VNGTHHFKITGYSLSKGIGIGKYIASDTFNVGGY 68 >ref|XP_007201051.1| BTB/POZ and MATH domain-containing protein 2 [Prunus persica] gb|ONH93671.1| hypothetical protein PRUPE_8G245800 [Prunus persica] Length = 409 Score = 67.8 bits (164), Expect = 2e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 306 VNGEHDFKISGYSLSKGIGIGKYIASDTFNVGGY 407 VNG H FKI+GYSLSKGIGIGKYIASDTFNVGGY Sbjct: 35 VNGTHHFKITGYSLSKGIGIGKYIASDTFNVGGY 68 >ref|XP_022890576.1| BTB/POZ and MATH domain-containing protein 2-like [Olea europaea var. sylvestris] Length = 410 Score = 67.8 bits (164), Expect = 2e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 306 VNGEHDFKISGYSLSKGIGIGKYIASDTFNVGGY 407 VNG HDFKI+GYSLSKGIGIGKYIASDTF VGGY Sbjct: 36 VNGSHDFKITGYSLSKGIGIGKYIASDTFMVGGY 69 >gb|PIN18183.1| Speckle-type POZ protein SPOP [Handroanthus impetiginosus] Length = 410 Score = 67.8 bits (164), Expect = 2e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 306 VNGEHDFKISGYSLSKGIGIGKYIASDTFNVGGY 407 VNG HDFKI+GYSLSKGIGIGKYIASDTF VGGY Sbjct: 36 VNGSHDFKITGYSLSKGIGIGKYIASDTFMVGGY 69 >ref|XP_011082543.1| BTB/POZ and MATH domain-containing protein 2 [Sesamum indicum] Length = 410 Score = 67.8 bits (164), Expect = 2e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 306 VNGEHDFKISGYSLSKGIGIGKYIASDTFNVGGY 407 VNG HDFKI+GYSLSKGIGIGKYIASDTF VGGY Sbjct: 36 VNGSHDFKITGYSLSKGIGIGKYIASDTFMVGGY 69 >ref|XP_011079801.1| BTB/POZ and MATH domain-containing protein 2-like [Sesamum indicum] Length = 410 Score = 67.8 bits (164), Expect = 2e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 306 VNGEHDFKISGYSLSKGIGIGKYIASDTFNVGGY 407 VNG HDFKI+GYSLSKGIGIGKYIASDTF VGGY Sbjct: 36 VNGSHDFKITGYSLSKGIGIGKYIASDTFMVGGY 69 >ref|XP_012832653.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Erythranthe guttata] gb|EYU46623.1| hypothetical protein MIMGU_mgv1a007354mg [Erythranthe guttata] Length = 410 Score = 67.8 bits (164), Expect = 2e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 306 VNGEHDFKISGYSLSKGIGIGKYIASDTFNVGGY 407 VNG HDFKI+GYSLSKGIGIGKYIASDTF VGGY Sbjct: 36 VNGSHDFKITGYSLSKGIGIGKYIASDTFMVGGY 69 >ref|XP_019240194.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Nicotiana attenuata] gb|OIT20425.1| btbpoz and math domain-containing protein 2 [Nicotiana attenuata] Length = 411 Score = 67.8 bits (164), Expect = 2e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 306 VNGEHDFKISGYSLSKGIGIGKYIASDTFNVGGY 407 VNG HDFKI+GYSLSKGIGIGKYIASDTF VGGY Sbjct: 37 VNGSHDFKITGYSLSKGIGIGKYIASDTFMVGGY 70 >ref|XP_015088180.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Solanum pennellii] Length = 411 Score = 67.8 bits (164), Expect = 2e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 306 VNGEHDFKISGYSLSKGIGIGKYIASDTFNVGGY 407 VNG HDFKI+GYSLSKGIGIGKYIASDTF VGGY Sbjct: 37 VNGSHDFKITGYSLSKGIGIGKYIASDTFMVGGY 70 >ref|XP_009599207.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Nicotiana tomentosiformis] ref|XP_016436729.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Nicotiana tabacum] Length = 411 Score = 67.8 bits (164), Expect = 2e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 306 VNGEHDFKISGYSLSKGIGIGKYIASDTFNVGGY 407 VNG HDFKI+GYSLSKGIGIGKYIASDTF VGGY Sbjct: 37 VNGSHDFKITGYSLSKGIGIGKYIASDTFMVGGY 70 >ref|XP_010326625.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Solanum lycopersicum] Length = 412 Score = 67.8 bits (164), Expect = 2e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 306 VNGEHDFKISGYSLSKGIGIGKYIASDTFNVGGY 407 VNG HDFKI+GYSLSKGIGIGKYIASDTF VGGY Sbjct: 38 VNGSHDFKITGYSLSKGIGIGKYIASDTFMVGGY 71 >ref|XP_015578209.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2 [Ricinus communis] Length = 413 Score = 67.8 bits (164), Expect = 2e-10 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 306 VNGEHDFKISGYSLSKGIGIGKYIASDTFNVGGY 407 VNG H FKI+GYSLSKG+GIGKYIASDTFNVGGY Sbjct: 39 VNGSHQFKITGYSLSKGLGIGKYIASDTFNVGGY 72 >gb|EEF37654.1| Speckle-type POZ protein, putative [Ricinus communis] Length = 500 Score = 67.8 bits (164), Expect = 2e-10 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 306 VNGEHDFKISGYSLSKGIGIGKYIASDTFNVGGY 407 VNG H FKI+GYSLSKG+GIGKYIASDTFNVGGY Sbjct: 39 VNGSHQFKITGYSLSKGLGIGKYIASDTFNVGGY 72 >ref|XP_022040816.1| BTB/POZ and MATH domain-containing protein 2-like [Helianthus annuus] gb|OTG35965.1| putative BTB-POZ and MATH domain 2 [Helianthus annuus] Length = 411 Score = 67.0 bits (162), Expect = 3e-10 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 306 VNGEHDFKISGYSLSKGIGIGKYIASDTFNVGGY 407 V GEH+FKISGYSLSKGIGIGKY+ASDTF VGGY Sbjct: 37 VKGEHNFKISGYSLSKGIGIGKYVASDTFTVGGY 70