BLASTX nr result
ID: Chrysanthemum21_contig00028592
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00028592 (366 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGM15312.1| embryonic flower 2_2 [Chrysanthemum x morifolium] 66 5e-10 gb|AJD87509.1| embryonic flower 2a [Dimocarpus longan] 62 2e-08 gb|PLY90238.1| hypothetical protein LSAT_8X9821 [Lactuca sativa] 60 4e-08 dbj|BAD93353.1| embryonic flower 2 [Silene latifolia] 60 4e-08 ref|XP_023757336.1| polycomb group protein EMBRYONIC FLOWER 2 is... 60 4e-08 ref|XP_023757334.1| polycomb group protein EMBRYONIC FLOWER 2 is... 60 4e-08 gb|OAY82534.1| Polycomb group protein EMBRYONIC FLOWER 2, partia... 57 4e-08 ref|XP_013712138.1| polycomb group protein EMBRYONIC FLOWER 2-li... 56 8e-08 gb|ABD85300.1| embryonic flower 2 [Yucca filamentosa] 59 1e-07 ref|XP_015899411.1| PREDICTED: polycomb group protein EMBRYONIC ... 59 1e-07 ref|XP_018810441.1| PREDICTED: polycomb group protein EMBRYONIC ... 59 1e-07 gb|PON83353.1| Polycomb protein, VEFS-Box [Trema orientalis] 59 1e-07 ref|XP_024018942.1| polycomb group protein EMBRYONIC FLOWER 2 is... 59 1e-07 ref|XP_024018941.1| polycomb group protein EMBRYONIC FLOWER 2 is... 59 1e-07 gb|PKI39454.1| hypothetical protein CRG98_040130 [Punica granatum] 57 1e-07 ref|XP_010647539.1| PREDICTED: polycomb group protein EMBRYONIC ... 57 1e-07 emb|CBI38524.3| unnamed protein product, partial [Vitis vinifera] 57 2e-07 gb|PON69775.1| Polycomb protein, VEFS-Box, partial [Parasponia a... 58 2e-07 ref|XP_010258768.1| PREDICTED: polycomb group protein EMBRYONIC ... 58 2e-07 ref|XP_010258766.1| PREDICTED: polycomb group protein EMBRYONIC ... 58 2e-07 >gb|AGM15312.1| embryonic flower 2_2 [Chrysanthemum x morifolium] Length = 616 Score = 65.9 bits (159), Expect = 5e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 101 RDK*VLADGHIPWACEAFSRLHGPDLVQAPSVL 3 R + VLADGHIPWACEAFSRLHGPDLVQAPSVL Sbjct: 537 RKQRVLADGHIPWACEAFSRLHGPDLVQAPSVL 569 >gb|AJD87509.1| embryonic flower 2a [Dimocarpus longan] Length = 649 Score = 61.6 bits (148), Expect = 2e-08 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -2 Query: 101 RDK*VLADGHIPWACEAFSRLHGPDLVQAPSVL 3 R + VLADGHIPWACEAF++LHGPDLVQAPS++ Sbjct: 576 RKQRVLADGHIPWACEAFTKLHGPDLVQAPSLI 608 >gb|PLY90238.1| hypothetical protein LSAT_8X9821 [Lactuca sativa] Length = 578 Score = 60.5 bits (145), Expect = 4e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 101 RDK*VLADGHIPWACEAFSRLHGPDLVQAPSVL 3 R + VLADGHIPWACEAFS+LHG DLVQAPS+L Sbjct: 545 RKQRVLADGHIPWACEAFSKLHGQDLVQAPSLL 577 >dbj|BAD93353.1| embryonic flower 2 [Silene latifolia] Length = 630 Score = 60.5 bits (145), Expect = 4e-08 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -2 Query: 101 RDK*VLADGHIPWACEAFSRLHGPDLVQAPSVL 3 R + V+ADGHIPWACEAFSRLHGPDLVQ P+++ Sbjct: 560 RKQHVIADGHIPWACEAFSRLHGPDLVQVPALI 592 >ref|XP_023757336.1| polycomb group protein EMBRYONIC FLOWER 2 isoform X2 [Lactuca sativa] ref|XP_023757337.1| polycomb group protein EMBRYONIC FLOWER 2 isoform X2 [Lactuca sativa] ref|XP_023757338.1| polycomb group protein EMBRYONIC FLOWER 2 isoform X2 [Lactuca sativa] Length = 632 Score = 60.5 bits (145), Expect = 4e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 101 RDK*VLADGHIPWACEAFSRLHGPDLVQAPSVL 3 R + VLADGHIPWACEAFS+LHG DLVQAPS+L Sbjct: 555 RKQRVLADGHIPWACEAFSKLHGQDLVQAPSLL 587 >ref|XP_023757334.1| polycomb group protein EMBRYONIC FLOWER 2 isoform X1 [Lactuca sativa] ref|XP_023757335.1| polycomb group protein EMBRYONIC FLOWER 2 isoform X1 [Lactuca sativa] Length = 645 Score = 60.5 bits (145), Expect = 4e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 101 RDK*VLADGHIPWACEAFSRLHGPDLVQAPSVL 3 R + VLADGHIPWACEAFS+LHG DLVQAPS+L Sbjct: 568 RKQRVLADGHIPWACEAFSKLHGQDLVQAPSLL 600 >gb|OAY82534.1| Polycomb group protein EMBRYONIC FLOWER 2, partial [Ananas comosus] Length = 85 Score = 56.6 bits (135), Expect = 4e-08 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -2 Query: 101 RDK*VLADGHIPWACEAFSRLHGPDLVQAPSVL 3 R + VLADGHIPWACEAFSRLHG DL +AP++L Sbjct: 52 RKQRVLADGHIPWACEAFSRLHGKDLSRAPALL 84 >ref|XP_013712138.1| polycomb group protein EMBRYONIC FLOWER 2-like [Brassica napus] Length = 96 Score = 56.2 bits (134), Expect = 8e-08 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -2 Query: 101 RDK*VLADGHIPWACEAFSRLHGPDLVQAPSVL 3 R + VLADGHIPWACEAFSRLHGP +VQ P ++ Sbjct: 24 RKQQVLADGHIPWACEAFSRLHGPIMVQRPDLI 56 >gb|ABD85300.1| embryonic flower 2 [Yucca filamentosa] Length = 699 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 101 RDK*VLADGHIPWACEAFSRLHGPDLVQAPSVL 3 R + VLADGHIPWACEAFSRLHG DLVQAP+++ Sbjct: 626 RKQRVLADGHIPWACEAFSRLHGQDLVQAPALV 658 >ref|XP_015899411.1| PREDICTED: polycomb group protein EMBRYONIC FLOWER 2-like [Ziziphus jujuba] Length = 268 Score = 58.5 bits (140), Expect = 1e-07 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = -2 Query: 101 RDK*VLADGHIPWACEAFSRLHGPDLVQAPSVL 3 R + VLADGHIPWACEAFS+LHGPDLV+ P+++ Sbjct: 196 RKQRVLADGHIPWACEAFSKLHGPDLVKTPALI 228 >ref|XP_018810441.1| PREDICTED: polycomb group protein EMBRYONIC FLOWER 2-like [Juglans regia] Length = 413 Score = 58.9 bits (141), Expect = 1e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -2 Query: 101 RDK*VLADGHIPWACEAFSRLHGPDLVQAPSVL 3 R + VLADGHIPWACEAFSRLHGPDLV+ P+++ Sbjct: 341 RKQRVLADGHIPWACEAFSRLHGPDLVRNPALI 373 >gb|PON83353.1| Polycomb protein, VEFS-Box [Trema orientalis] Length = 610 Score = 58.9 bits (141), Expect = 1e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -2 Query: 101 RDK*VLADGHIPWACEAFSRLHGPDLVQAPSVL 3 R + VLADGHIPWACEAFS+LHGPDLV+ PS++ Sbjct: 538 RKQRVLADGHIPWACEAFSKLHGPDLVKNPSLI 570 >ref|XP_024018942.1| polycomb group protein EMBRYONIC FLOWER 2 isoform X2 [Morus notabilis] Length = 616 Score = 58.9 bits (141), Expect = 1e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -2 Query: 101 RDK*VLADGHIPWACEAFSRLHGPDLVQAPSVL 3 R + VLADGHIPWACEAFS+LHGPDLV+ PS++ Sbjct: 544 RKQRVLADGHIPWACEAFSKLHGPDLVKNPSLI 576 >ref|XP_024018941.1| polycomb group protein EMBRYONIC FLOWER 2 isoform X1 [Morus notabilis] Length = 617 Score = 58.9 bits (141), Expect = 1e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -2 Query: 101 RDK*VLADGHIPWACEAFSRLHGPDLVQAPSVL 3 R + VLADGHIPWACEAFS+LHGPDLV+ PS++ Sbjct: 545 RKQRVLADGHIPWACEAFSKLHGPDLVKNPSLI 577 >gb|PKI39454.1| hypothetical protein CRG98_040130 [Punica granatum] Length = 160 Score = 57.0 bits (136), Expect = 1e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 101 RDK*VLADGHIPWACEAFSRLHGPDLVQAPSV 6 R + VLADGHIPWACEAFSRLHG DLV+AP++ Sbjct: 87 RKQRVLADGHIPWACEAFSRLHGHDLVRAPAL 118 >ref|XP_010647539.1| PREDICTED: polycomb group protein EMBRYONIC FLOWER 2 [Vitis vinifera] Length = 164 Score = 57.0 bits (136), Expect = 1e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -2 Query: 101 RDK*VLADGHIPWACEAFSRLHGPDLVQAPSV 6 R + VLADGHIPWACEAFS+LHG +LVQAP++ Sbjct: 91 RKQRVLADGHIPWACEAFSKLHGQELVQAPAI 122 >emb|CBI38524.3| unnamed protein product, partial [Vitis vinifera] Length = 182 Score = 57.0 bits (136), Expect = 2e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -2 Query: 101 RDK*VLADGHIPWACEAFSRLHGPDLVQAPSV 6 R + VLADGHIPWACEAFS+LHG +LVQAP++ Sbjct: 109 RKQRVLADGHIPWACEAFSKLHGQELVQAPAI 140 >gb|PON69775.1| Polycomb protein, VEFS-Box, partial [Parasponia andersonii] Length = 276 Score = 57.8 bits (138), Expect = 2e-07 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = -2 Query: 101 RDK*VLADGHIPWACEAFSRLHGPDLVQAPSVL 3 R + VLADGHIPWACEAFS+LHGPDLV+ P+++ Sbjct: 204 RKQRVLADGHIPWACEAFSKLHGPDLVKNPTLI 236 >ref|XP_010258768.1| PREDICTED: polycomb group protein EMBRYONIC FLOWER 2-like isoform X4 [Nelumbo nucifera] Length = 489 Score = 58.2 bits (139), Expect = 2e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -2 Query: 101 RDK*VLADGHIPWACEAFSRLHGPDLVQAPSVL 3 R + VLADGHIPWACEAFSRLHG DLV+AP+++ Sbjct: 416 RKQRVLADGHIPWACEAFSRLHGKDLVRAPNLI 448 >ref|XP_010258766.1| PREDICTED: polycomb group protein EMBRYONIC FLOWER 2-like isoform X3 [Nelumbo nucifera] Length = 500 Score = 58.2 bits (139), Expect = 2e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -2 Query: 101 RDK*VLADGHIPWACEAFSRLHGPDLVQAPSVL 3 R + VLADGHIPWACEAFSRLHG DLV+AP+++ Sbjct: 427 RKQRVLADGHIPWACEAFSRLHGKDLVRAPNLI 459