BLASTX nr result
ID: Chrysanthemum21_contig00028523
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00028523 (405 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021978510.1| heavy metal-associated isoprenylated plant p... 58 3e-07 ref|XP_023738128.1| heavy metal-associated isoprenylated plant p... 55 5e-06 >ref|XP_021978510.1| heavy metal-associated isoprenylated plant protein 3-like [Helianthus annuus] gb|OTG37353.1| putative heavy metal transport/detoxification superfamily protein [Helianthus annuus] Length = 313 Score = 58.2 bits (139), Expect = 3e-07 Identities = 36/72 (50%), Positives = 41/72 (56%) Frame = +2 Query: 98 VTTHILPDPLHSRNKPNTTLNPFTXXXXXXXXXXXXXDKEKDLVTVKGAIDMKILATALQ 277 VTT +L PLH + T DK KDLVTVKGAIDMK+LA ALQ Sbjct: 152 VTTGVLKVPLHCQGCIRRIYKLVTKTKGFMDMSF---DKNKDLVTVKGAIDMKLLAEALQ 208 Query: 278 SKLKRAVEMVPA 313 KLKR VE+VP+ Sbjct: 209 EKLKRGVEVVPS 220 >ref|XP_023738128.1| heavy metal-associated isoprenylated plant protein 3-like [Lactuca sativa] gb|PLY70441.1| hypothetical protein LSAT_1X62921 [Lactuca sativa] Length = 340 Score = 54.7 bits (130), Expect = 5e-06 Identities = 34/73 (46%), Positives = 40/73 (54%) Frame = +2 Query: 95 SVTTHILPDPLHSRNKPNTTLNPFTXXXXXXXXXXXXXDKEKDLVTVKGAIDMKILATAL 274 SVTT +L PLH + DK KDLVTVKGA DMK+LA L Sbjct: 174 SVTTAVLKVPLHCQG---CVRKIHKIISKTKGFIEMSIDKNKDLVTVKGATDMKMLAEVL 230 Query: 275 QSKLKRAVEMVPA 313 + KLK+AVE+VPA Sbjct: 231 KQKLKKAVEIVPA 243