BLASTX nr result
ID: Chrysanthemum21_contig00028440
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00028440 (357 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021811807.1| protein WVD2-like 4 [Prunus avium] 54 7e-06 ref|XP_008241097.1| PREDICTED: protein WVD2-like 4 [Prunus mume] 54 7e-06 >ref|XP_021811807.1| protein WVD2-like 4 [Prunus avium] Length = 483 Score = 53.9 bits (128), Expect = 7e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 91 ERQEAETNKVRKSSTFKAAPLPSFYKEPPP 2 E QEAE K+RKS TFKAAP+PSFYKEPPP Sbjct: 296 ESQEAEIKKLRKSLTFKAAPMPSFYKEPPP 325 >ref|XP_008241097.1| PREDICTED: protein WVD2-like 4 [Prunus mume] Length = 483 Score = 53.9 bits (128), Expect = 7e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 91 ERQEAETNKVRKSSTFKAAPLPSFYKEPPP 2 E QEAE K+RKS TFKAAP+PSFYKEPPP Sbjct: 296 ESQEAEIKKLRKSLTFKAAPMPSFYKEPPP 325