BLASTX nr result
ID: Chrysanthemum21_contig00028302
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00028302 (703 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023769699.1| bifunctional dihydrofolate reductase-thymidy... 60 6e-07 ref|XP_022002963.1| bifunctional dihydrofolate reductase-thymidy... 60 6e-07 ref|XP_022028308.1| bifunctional dihydrofolate reductase-thymidy... 60 6e-07 ref|XP_023760189.1| bifunctional dihydrofolate reductase-thymidy... 60 6e-07 ref|XP_023760186.1| bifunctional dihydrofolate reductase-thymidy... 60 6e-07 gb|PLY88256.1| hypothetical protein LSAT_4X93741 [Lactuca sativa] 60 6e-07 gb|OTG03663.1| putative bifunctional dihydrofolate reductase-thy... 60 6e-07 gb|PIA56093.1| hypothetical protein AQUCO_00700444v1 [Aquilegia ... 57 6e-06 gb|PIA55835.1| hypothetical protein AQUCO_00700274v1 [Aquilegia ... 57 6e-06 gb|PIA55833.1| hypothetical protein AQUCO_00700274v1 [Aquilegia ... 57 7e-06 gb|PIA55836.1| hypothetical protein AQUCO_00700274v1 [Aquilegia ... 57 7e-06 ref|XP_003537861.1| PREDICTED: bifunctional dihydrofolate reduct... 57 9e-06 ref|XP_019165413.1| PREDICTED: putative bifunctional dihydrofola... 57 9e-06 gb|PNT41461.1| hypothetical protein POPTR_004G157400v3 [Populus ... 56 1e-05 >ref|XP_023769699.1| bifunctional dihydrofolate reductase-thymidylate synthase 1-like [Lactuca sativa] gb|PLY80994.1| hypothetical protein LSAT_9X108200 [Lactuca sativa] Length = 526 Score = 60.5 bits (145), Expect = 6e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 9 SAQKVLQDKGIHIWDGNASRSYLDSIGLVDR 101 ++ KVLQDKGIHIWDGNASR+YLDSIGLVDR Sbjct: 309 TSAKVLQDKGIHIWDGNASRTYLDSIGLVDR 339 >ref|XP_022002963.1| bifunctional dihydrofolate reductase-thymidylate synthase 1-like [Helianthus annuus] ref|XP_022002964.1| bifunctional dihydrofolate reductase-thymidylate synthase 1-like [Helianthus annuus] ref|XP_022002965.1| bifunctional dihydrofolate reductase-thymidylate synthase 1-like [Helianthus annuus] ref|XP_022002966.1| bifunctional dihydrofolate reductase-thymidylate synthase 1-like [Helianthus annuus] ref|XP_022002967.1| bifunctional dihydrofolate reductase-thymidylate synthase 1-like [Helianthus annuus] ref|XP_022002968.1| bifunctional dihydrofolate reductase-thymidylate synthase 1-like [Helianthus annuus] ref|XP_022002969.1| bifunctional dihydrofolate reductase-thymidylate synthase 1-like [Helianthus annuus] Length = 527 Score = 60.5 bits (145), Expect = 6e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 9 SAQKVLQDKGIHIWDGNASRSYLDSIGLVDR 101 ++ KVLQDKGIHIWDGNASR+YLDSIGLVDR Sbjct: 310 TSAKVLQDKGIHIWDGNASRNYLDSIGLVDR 340 >ref|XP_022028308.1| bifunctional dihydrofolate reductase-thymidylate synthase 1-like [Helianthus annuus] ref|XP_022028309.1| bifunctional dihydrofolate reductase-thymidylate synthase 1-like [Helianthus annuus] ref|XP_022028310.1| bifunctional dihydrofolate reductase-thymidylate synthase 1-like [Helianthus annuus] ref|XP_022028311.1| bifunctional dihydrofolate reductase-thymidylate synthase 1-like [Helianthus annuus] gb|OTG31243.1| putative thymidylate synthase 1 [Helianthus annuus] Length = 527 Score = 60.5 bits (145), Expect = 6e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 9 SAQKVLQDKGIHIWDGNASRSYLDSIGLVDR 101 ++ KVLQDKGIHIWDGNASR+YLDSIGLVDR Sbjct: 310 TSAKVLQDKGIHIWDGNASRNYLDSIGLVDR 340 >ref|XP_023760189.1| bifunctional dihydrofolate reductase-thymidylate synthase-like isoform X2 [Lactuca sativa] Length = 553 Score = 60.5 bits (145), Expect = 6e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 9 SAQKVLQDKGIHIWDGNASRSYLDSIGLVDR 101 ++ KVLQDKGIHIWDGNASR+YLDSIGLVDR Sbjct: 350 TSAKVLQDKGIHIWDGNASRTYLDSIGLVDR 380 >ref|XP_023760186.1| bifunctional dihydrofolate reductase-thymidylate synthase-like isoform X1 [Lactuca sativa] ref|XP_023760187.1| bifunctional dihydrofolate reductase-thymidylate synthase-like isoform X1 [Lactuca sativa] ref|XP_023760188.1| bifunctional dihydrofolate reductase-thymidylate synthase-like isoform X1 [Lactuca sativa] Length = 567 Score = 60.5 bits (145), Expect = 6e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 9 SAQKVLQDKGIHIWDGNASRSYLDSIGLVDR 101 ++ KVLQDKGIHIWDGNASR+YLDSIGLVDR Sbjct: 350 TSAKVLQDKGIHIWDGNASRTYLDSIGLVDR 380 >gb|PLY88256.1| hypothetical protein LSAT_4X93741 [Lactuca sativa] Length = 569 Score = 60.5 bits (145), Expect = 6e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 9 SAQKVLQDKGIHIWDGNASRSYLDSIGLVDR 101 ++ KVLQDKGIHIWDGNASR+YLDSIGLVDR Sbjct: 352 TSAKVLQDKGIHIWDGNASRTYLDSIGLVDR 382 >gb|OTG03663.1| putative bifunctional dihydrofolate reductase-thymidylate synthase [Helianthus annuus] Length = 619 Score = 60.5 bits (145), Expect = 6e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 9 SAQKVLQDKGIHIWDGNASRSYLDSIGLVDR 101 ++ KVLQDKGIHIWDGNASR+YLDSIGLVDR Sbjct: 402 TSAKVLQDKGIHIWDGNASRNYLDSIGLVDR 432 >gb|PIA56093.1| hypothetical protein AQUCO_00700444v1 [Aquilegia coerulea] Length = 411 Score = 57.4 bits (137), Expect = 6e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +3 Query: 18 KVLQDKGIHIWDGNASRSYLDSIGLVDR 101 KVLQ+KG+HIWDGNASR YLDS+GLVDR Sbjct: 223 KVLQEKGVHIWDGNASRDYLDSVGLVDR 250 >gb|PIA55835.1| hypothetical protein AQUCO_00700274v1 [Aquilegia coerulea] Length = 487 Score = 57.4 bits (137), Expect = 6e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +3 Query: 18 KVLQDKGIHIWDGNASRSYLDSIGLVDR 101 KVLQ+KG+HIWDGNASR YLDS+GLVDR Sbjct: 310 KVLQEKGVHIWDGNASRDYLDSVGLVDR 337 >gb|PIA55833.1| hypothetical protein AQUCO_00700274v1 [Aquilegia coerulea] gb|PIA55837.1| hypothetical protein AQUCO_00700274v1 [Aquilegia coerulea] Length = 524 Score = 57.4 bits (137), Expect = 7e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +3 Query: 18 KVLQDKGIHIWDGNASRSYLDSIGLVDR 101 KVLQ+KG+HIWDGNASR YLDS+GLVDR Sbjct: 310 KVLQEKGVHIWDGNASRDYLDSVGLVDR 337 >gb|PIA55836.1| hypothetical protein AQUCO_00700274v1 [Aquilegia coerulea] Length = 543 Score = 57.4 bits (137), Expect = 7e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +3 Query: 18 KVLQDKGIHIWDGNASRSYLDSIGLVDR 101 KVLQ+KG+HIWDGNASR YLDS+GLVDR Sbjct: 366 KVLQEKGVHIWDGNASRDYLDSVGLVDR 393 >ref|XP_003537861.1| PREDICTED: bifunctional dihydrofolate reductase-thymidylate synthase-like [Glycine max] gb|KRH29421.1| hypothetical protein GLYMA_11G115200 [Glycine max] Length = 528 Score = 57.0 bits (136), Expect = 9e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +3 Query: 9 SAQKVLQDKGIHIWDGNASRSYLDSIGLVDR 101 ++ KVLQ+KGIHIWDGNASR YLDSIGL DR Sbjct: 311 TSAKVLQEKGIHIWDGNASREYLDSIGLTDR 341 >ref|XP_019165413.1| PREDICTED: putative bifunctional dihydrofolate reductase-thymidylate synthase [Ipomoea nil] ref|XP_019165414.1| PREDICTED: putative bifunctional dihydrofolate reductase-thymidylate synthase [Ipomoea nil] Length = 533 Score = 57.0 bits (136), Expect = 9e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +3 Query: 18 KVLQDKGIHIWDGNASRSYLDSIGLVDR 101 K+LQ+KGIHIWDGNASR YLDSIGLVDR Sbjct: 319 KLLQEKGIHIWDGNASRDYLDSIGLVDR 346 >gb|PNT41461.1| hypothetical protein POPTR_004G157400v3 [Populus trichocarpa] Length = 278 Score = 56.2 bits (134), Expect = 1e-05 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +3 Query: 9 SAQKVLQDKGIHIWDGNASRSYLDSIGLVDR 101 ++ KVLQ+KGIHIWDGNASR YLDSIGL DR Sbjct: 61 TSAKVLQEKGIHIWDGNASREYLDSIGLKDR 91