BLASTX nr result
ID: Chrysanthemum21_contig00028292
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00028292 (370 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021988992.1| pentatricopeptide repeat-containing protein ... 67 1e-10 gb|KVH96663.1| Pentatricopeptide repeat-containing protein [Cyna... 59 1e-07 >ref|XP_021988992.1| pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Helianthus annuus] gb|OTG11663.1| putative tetratricopeptide repeat (TPR)-like superfamily protein [Helianthus annuus] Length = 451 Score = 67.4 bits (163), Expect = 1e-10 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +3 Query: 3 LSACLDYLNSKGKLDEAEEIIRLLKEKGHLSEVVYNSIVK 122 LSACLDYLN +G+LDE EE+I+LLKEKGHLSE VY S+VK Sbjct: 410 LSACLDYLNREGRLDEGEEMIKLLKEKGHLSEEVYKSVVK 449 >gb|KVH96663.1| Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 486 Score = 59.3 bits (142), Expect = 1e-07 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = +3 Query: 3 LSACLDYLNSKGKLDEAEEIIRLLKEKGHLSEVVYNSIVKKLS 131 LSACLDYL+ KG L+EAEE+I+ L +KGHLSE VY I+K LS Sbjct: 435 LSACLDYLDHKGHLNEAEEMIKSLHQKGHLSEGVYMGILKNLS 477