BLASTX nr result
ID: Chrysanthemum21_contig00028004
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00028004 (471 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH95113.1| Biopterin transport-related protein BT1 [Cynara c... 91 2e-18 ref|XP_022020636.1| probable folate-biopterin transporter 2 [Hel... 77 3e-13 ref|XP_023768751.1| probable folate-biopterin transporter 2 [Lac... 70 4e-11 >gb|KVH95113.1| Biopterin transport-related protein BT1 [Cynara cardunculus var. scolymus] Length = 519 Score = 91.3 bits (225), Expect = 2e-18 Identities = 47/58 (81%), Positives = 51/58 (87%) Frame = -1 Query: 471 FLFLVPKSGPDSLGFSRMEVLDIVEDSESCIEVSTILEDSKLSKPEEVELTPLVSNVG 298 FLFLVPKS P+S GFSRMEVL I+ED ES IEVS ILEDS+LSK EEVELTPLVSN+G Sbjct: 462 FLFLVPKSSPESSGFSRMEVLSILEDGESHIEVSGILEDSELSKSEEVELTPLVSNIG 519 >ref|XP_022020636.1| probable folate-biopterin transporter 2 [Helianthus annuus] gb|OTF85108.1| putative major facilitator superfamily protein [Helianthus annuus] Length = 513 Score = 76.6 bits (187), Expect = 3e-13 Identities = 38/56 (67%), Positives = 46/56 (82%) Frame = -1 Query: 471 FLFLVPKSGPDSLGFSRMEVLDIVEDSESCIEVSTILEDSKLSKPEEVELTPLVSN 304 FLFLVPK G DS GFSR+EVL +V+D ES IEV ++ ED++ SK EEVELTPLVS+ Sbjct: 458 FLFLVPKGGSDSSGFSRLEVLQVVDDGESDIEVLSVSEDAEASKAEEVELTPLVSS 513 >ref|XP_023768751.1| probable folate-biopterin transporter 2 [Lactuca sativa] ref|XP_023768752.1| probable folate-biopterin transporter 2 [Lactuca sativa] ref|XP_023768753.1| probable folate-biopterin transporter 2 [Lactuca sativa] gb|PLY81772.1| hypothetical protein LSAT_3X22800 [Lactuca sativa] Length = 520 Score = 70.5 bits (171), Expect = 4e-11 Identities = 38/60 (63%), Positives = 48/60 (80%), Gaps = 3/60 (5%) Frame = -1 Query: 471 FLFLVPKSGPDSLGFSRMEVLDIVEDSESCIEVSTILEDSK---LSKPEEVELTPLVSNV 301 FLFLVPKS +SLGFSRMEVL+++EDSE+ I+VS+ LE+ L EEVELTPLV++V Sbjct: 459 FLFLVPKSDAESLGFSRMEVLNVLEDSENGIQVSSSLEEDSEILLKHAEEVELTPLVTSV 518