BLASTX nr result
ID: Chrysanthemum21_contig00027913
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00027913 (374 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023765187.1| TPR repeat-containing thioredoxin TTL1-like ... 67 2e-10 gb|KVI10475.1| Tetratricopeptide-like helical [Cynara cardunculu... 66 6e-10 ref|XP_022013348.1| TPR repeat-containing thioredoxin TTL1-like ... 65 1e-09 ref|XP_021998177.1| TPR repeat-containing thioredoxin TTL1-like ... 65 1e-09 ref|XP_022028763.1| TPR repeat-containing thioredoxin TTL1-like ... 64 4e-09 ref|XP_016581141.1| PREDICTED: TPR repeat-containing thioredoxin... 63 7e-09 gb|PHT43848.1| Inactive TPR repeat-containing thioredoxin TTL3 [... 63 7e-09 gb|PHT77067.1| TPR repeat-containing thioredoxin TTL1 [Capsicum ... 63 7e-09 ref|XP_023771341.1| TPR repeat-containing thioredoxin TTL1-like ... 62 9e-09 ref|XP_006348295.1| PREDICTED: TPR repeat-containing thioredoxin... 62 9e-09 ref|XP_004244266.1| PREDICTED: TPR repeat-containing thioredoxin... 62 9e-09 gb|PLY79656.1| hypothetical protein LSAT_5X126841 [Lactuca sativa] 62 9e-09 gb|KVI02206.1| Tetratricopeptide-like helical [Cynara cardunculu... 62 1e-08 gb|PHU12678.1| hypothetical protein BC332_19608 [Capsicum chinense] 62 2e-08 ref|XP_015082350.1| PREDICTED: TPR repeat-containing thioredoxin... 61 2e-08 gb|EYU45013.1| hypothetical protein MIMGU_mgv1a0029402mg, partia... 60 4e-08 ref|XP_015089693.1| PREDICTED: inactive TPR repeat-containing th... 60 4e-08 ref|XP_012848612.1| PREDICTED: TPR repeat-containing thioredoxin... 60 4e-08 emb|CDP06000.1| unnamed protein product [Coffea canephora] 60 4e-08 ref|XP_011098231.1| TPR repeat-containing thioredoxin TTL1 [Sesa... 60 4e-08 >ref|XP_023765187.1| TPR repeat-containing thioredoxin TTL1-like [Lactuca sativa] gb|PLY98235.1| hypothetical protein LSAT_7X103460 [Lactuca sativa] Length = 702 Score = 67.4 bits (163), Expect = 2e-10 Identities = 31/41 (75%), Positives = 39/41 (95%) Frame = +1 Query: 250 SKSAALICMKRLSEAVKGCEEAIRLDSCYVRAHHRLGSLLI 372 +++AAL+C+KRL+EAVK C+EAI+LDS YVRAHHRLGSLLI Sbjct: 268 NRAAALMCLKRLTEAVKECDEAIKLDSGYVRAHHRLGSLLI 308 >gb|KVI10475.1| Tetratricopeptide-like helical [Cynara cardunculus var. scolymus] Length = 709 Score = 65.9 bits (159), Expect = 6e-10 Identities = 30/41 (73%), Positives = 39/41 (95%) Frame = +1 Query: 250 SKSAALICMKRLSEAVKGCEEAIRLDSCYVRAHHRLGSLLI 372 +++AAL+C+KRL+EAVK C+EAI+L+S YVRAHHRLGSLLI Sbjct: 275 NRAAALMCLKRLTEAVKECDEAIKLESGYVRAHHRLGSLLI 315 >ref|XP_022013348.1| TPR repeat-containing thioredoxin TTL1-like [Helianthus annuus] gb|OTF96459.1| putative tetratricopetide-repeat thioredoxin-like 1 [Helianthus annuus] Length = 684 Score = 65.1 bits (157), Expect = 1e-09 Identities = 32/48 (66%), Positives = 40/48 (83%) Frame = +1 Query: 229 VDTQARSSKSAALICMKRLSEAVKGCEEAIRLDSCYVRAHHRLGSLLI 372 V+ +++AAL+ +KRLSEAVK C+EAIRLDS YVRAHHRLGSLL+ Sbjct: 243 VNAAYHCNRAAALMGLKRLSEAVKECDEAIRLDSGYVRAHHRLGSLLV 290 >ref|XP_021998177.1| TPR repeat-containing thioredoxin TTL1-like [Helianthus annuus] gb|OTG05428.1| putative thioredoxin-like fold, N-terminal acetyltransferase A, auxiliary subunit [Helianthus annuus] Length = 672 Score = 64.7 bits (156), Expect = 1e-09 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +1 Query: 250 SKSAALICMKRLSEAVKGCEEAIRLDSCYVRAHHRLGSLLI 372 ++SAAL+C+ RL EAVK CEEA++LDS YVRAHHRLGS LI Sbjct: 238 NRSAALMCLNRLVEAVKECEEAVKLDSGYVRAHHRLGSFLI 278 >ref|XP_022028763.1| TPR repeat-containing thioredoxin TTL1-like [Helianthus annuus] gb|OTG31754.1| putative tetratricopeptide-like helical domain, Thioredoxin-like fold protein [Helianthus annuus] Length = 673 Score = 63.5 bits (153), Expect = 4e-09 Identities = 30/41 (73%), Positives = 38/41 (92%) Frame = +1 Query: 250 SKSAALICMKRLSEAVKGCEEAIRLDSCYVRAHHRLGSLLI 372 +++AAL+ +KRLSEAVK C+EAI+LDS YVRAHHRLGSLL+ Sbjct: 238 NRAAALMGLKRLSEAVKECDEAIKLDSGYVRAHHRLGSLLV 278 >ref|XP_016581141.1| PREDICTED: TPR repeat-containing thioredoxin TTL1 [Capsicum annuum] Length = 678 Score = 62.8 bits (151), Expect = 7e-09 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +1 Query: 250 SKSAALICMKRLSEAVKGCEEAIRLDSCYVRAHHRLGSLLI 372 +++AALI +KRL EAVK CEEA+RLD YVRAHHRLGSLL+ Sbjct: 246 NRAAALIGLKRLLEAVKECEEAVRLDPSYVRAHHRLGSLLL 286 >gb|PHT43848.1| Inactive TPR repeat-containing thioredoxin TTL3 [Capsicum baccatum] Length = 680 Score = 62.8 bits (151), Expect = 7e-09 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +1 Query: 250 SKSAALICMKRLSEAVKGCEEAIRLDSCYVRAHHRLGSLLI 372 +++AALI +KRL EAVK CEEA+RLD YVRAHHRLGSLL+ Sbjct: 248 NRAAALIGLKRLLEAVKECEEAVRLDPSYVRAHHRLGSLLL 288 >gb|PHT77067.1| TPR repeat-containing thioredoxin TTL1 [Capsicum annuum] Length = 732 Score = 62.8 bits (151), Expect = 7e-09 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +1 Query: 250 SKSAALICMKRLSEAVKGCEEAIRLDSCYVRAHHRLGSLLI 372 +++AALI +KRL EAVK CEEA+RLD YVRAHHRLGSLL+ Sbjct: 246 NRAAALIGLKRLLEAVKECEEAVRLDPSYVRAHHRLGSLLL 286 >ref|XP_023771341.1| TPR repeat-containing thioredoxin TTL1-like [Lactuca sativa] Length = 694 Score = 62.4 bits (150), Expect = 9e-09 Identities = 31/51 (60%), Positives = 41/51 (80%), Gaps = 1/51 (1%) Frame = +1 Query: 223 ISVDTQA-RSSKSAALICMKRLSEAVKGCEEAIRLDSCYVRAHHRLGSLLI 372 +S D A ++SAAL+C+ RL++AVK C+ AI+LDS Y+RAHHRLGSLLI Sbjct: 254 VSPDNAAYHCNRSAALMCLNRLTDAVKECDLAIKLDSGYIRAHHRLGSLLI 304 >ref|XP_006348295.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Solanum tuberosum] Length = 700 Score = 62.4 bits (150), Expect = 9e-09 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +1 Query: 250 SKSAALICMKRLSEAVKGCEEAIRLDSCYVRAHHRLGSLLI 372 +++AALI +KRL EAV+ CEEAIRLD YVRAHHRLGSLL+ Sbjct: 268 NRAAALIGLKRLPEAVRECEEAIRLDPSYVRAHHRLGSLLL 308 >ref|XP_004244266.1| PREDICTED: TPR repeat-containing thioredoxin TTL1 [Solanum lycopersicum] Length = 701 Score = 62.4 bits (150), Expect = 9e-09 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +1 Query: 250 SKSAALICMKRLSEAVKGCEEAIRLDSCYVRAHHRLGSLLI 372 +++AALI +KRL EAV+ CEEAIRLD YVRAHHRLGSLL+ Sbjct: 268 NRAAALIGLKRLPEAVRECEEAIRLDPSYVRAHHRLGSLLL 308 >gb|PLY79656.1| hypothetical protein LSAT_5X126841 [Lactuca sativa] Length = 766 Score = 62.4 bits (150), Expect = 9e-09 Identities = 31/51 (60%), Positives = 41/51 (80%), Gaps = 1/51 (1%) Frame = +1 Query: 223 ISVDTQA-RSSKSAALICMKRLSEAVKGCEEAIRLDSCYVRAHHRLGSLLI 372 +S D A ++SAAL+C+ RL++AVK C+ AI+LDS Y+RAHHRLGSLLI Sbjct: 254 VSPDNAAYHCNRSAALMCLNRLTDAVKECDLAIKLDSGYIRAHHRLGSLLI 304 >gb|KVI02206.1| Tetratricopeptide-like helical [Cynara cardunculus var. scolymus] Length = 652 Score = 62.0 bits (149), Expect = 1e-08 Identities = 29/41 (70%), Positives = 37/41 (90%) Frame = +1 Query: 250 SKSAALICMKRLSEAVKGCEEAIRLDSCYVRAHHRLGSLLI 372 ++ AAL+ +KRL++AVK C+EAI+LDS YVRAHHRLGSLLI Sbjct: 249 NRGAALMSLKRLTDAVKECDEAIKLDSGYVRAHHRLGSLLI 289 >gb|PHU12678.1| hypothetical protein BC332_19608 [Capsicum chinense] Length = 629 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = +1 Query: 250 SKSAALICMKRLSEAVKGCEEAIRLDSCYVRAHHRLGSLLI 372 +++AALI +KRL EAVK CEEA+RLD YVRAHHRLGSL++ Sbjct: 244 NRAAALIGLKRLLEAVKECEEAVRLDPSYVRAHHRLGSLVL 284 >ref|XP_015082350.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Solanum pennellii] Length = 698 Score = 61.2 bits (147), Expect = 2e-08 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = +1 Query: 250 SKSAALICMKRLSEAVKGCEEAIRLDSCYVRAHHRLGSLLI 372 +++AALI +KRL EAV+ CEEAI+LD YVRAHHRLGSLL+ Sbjct: 266 NRAAALIGLKRLPEAVRECEEAIKLDPSYVRAHHRLGSLLL 306 >gb|EYU45013.1| hypothetical protein MIMGU_mgv1a0029402mg, partial [Erythranthe guttata] Length = 537 Score = 60.5 bits (145), Expect = 4e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = +1 Query: 250 SKSAALICMKRLSEAVKGCEEAIRLDSCYVRAHHRLGSLLI 372 ++SAAL+ ++RLSEA + CEEAIRLD Y RAHHRLGSLL+ Sbjct: 263 NRSAALMALRRLSEAARECEEAIRLDPGYARAHHRLGSLLL 303 >ref|XP_015089693.1| PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like [Solanum pennellii] Length = 580 Score = 60.5 bits (145), Expect = 4e-08 Identities = 29/47 (61%), Positives = 38/47 (80%) Frame = +1 Query: 232 DTQARSSKSAALICMKRLSEAVKGCEEAIRLDSCYVRAHHRLGSLLI 372 D + R +++AAL+ +KR+SEA+K CEEAIRL YVRAH RLGSLL+ Sbjct: 146 DGRLRCNRAAALMVLKRISEALKECEEAIRLAPAYVRAHQRLGSLLL 192 >ref|XP_012848612.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Erythranthe guttata] Length = 627 Score = 60.5 bits (145), Expect = 4e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = +1 Query: 250 SKSAALICMKRLSEAVKGCEEAIRLDSCYVRAHHRLGSLLI 372 ++SAAL+ ++RLSEA + CEEAIRLD Y RAHHRLGSLL+ Sbjct: 263 NRSAALMALRRLSEAARECEEAIRLDPGYARAHHRLGSLLL 303 >emb|CDP06000.1| unnamed protein product [Coffea canephora] Length = 692 Score = 60.5 bits (145), Expect = 4e-08 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +1 Query: 250 SKSAALICMKRLSEAVKGCEEAIRLDSCYVRAHHRLGSLLI 372 +++AALI +KR EAV+ CEEAIRLD YVRAHHRLGSLL+ Sbjct: 259 NRAAALIGLKRFPEAVRECEEAIRLDPGYVRAHHRLGSLLV 299 >ref|XP_011098231.1| TPR repeat-containing thioredoxin TTL1 [Sesamum indicum] Length = 696 Score = 60.5 bits (145), Expect = 4e-08 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = +1 Query: 250 SKSAALICMKRLSEAVKGCEEAIRLDSCYVRAHHRLGSLLI 372 +++AAL+ +KRL EAV+ CEEAIRLD YVRAHHRLG+LL+ Sbjct: 263 NRAAALMVLKRLGEAVRECEEAIRLDPGYVRAHHRLGALLL 303