BLASTX nr result
ID: Chrysanthemum21_contig00027900
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00027900 (380 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KNG51441.1| 60s ribosomal protein l26 [Stemphylium lycopersici] 139 3e-40 ref|XP_018387710.1| ribosomal protein L24 [Alternaria alternata]... 138 1e-39 ref|XP_007713820.1| hypothetical protein COCCADRAFT_100136 [Bipo... 135 1e-38 ref|XP_001930861.1| 60S ribosomal protein L26 [Pyrenophora triti... 135 2e-38 ref|XP_014082578.1| hypothetical protein COCC4DRAFT_30433 [Bipol... 135 2e-38 ref|XP_007702866.1| hypothetical protein COCSADRAFT_344402 [Bipo... 134 8e-38 gb|OAL50808.1| ribosomal protein L24 [Pyrenochaeta sp. DS3sAY3a] 133 1e-37 ref|XP_007687056.1| hypothetical protein COCMIDRAFT_92753 [Bipol... 132 2e-37 ref|XP_008030388.1| hypothetical protein SETTUDRAFT_97180 [Setos... 132 2e-37 ref|XP_001797270.1| hypothetical protein SNOG_06909 [Parastagono... 130 2e-36 gb|OAK98745.1| ribosomal protein L24 [Stagonospora sp. SRC1lsM3a] 127 2e-35 ref|XP_003836074.1| similar to 60S ribosomal protein L26 [Leptos... 126 6e-35 gb|KZM21807.1| structural constituent of ribosome [Ascochyta rab... 125 2e-34 ref|XP_018043097.1| ribosomal protein L24 [Paraphaeosphaeria spo... 122 2e-33 gb|OSS45766.1| hypothetical protein B5807_09594 [Epicoccum nigrum] 121 5e-33 gb|ORY06635.1| translation protein SH3-like domain-containing pr... 113 1e-29 emb|CCU74360.1| 60S ribosomal protein L26 [Blumeria graminis f. ... 110 1e-28 emb|CEL04641.1| Putative Ribosomal protein L26 (AFU_orthologue; ... 110 1e-28 gb|EPQ62114.1| hypothetical protein BGT96224_A20452 [Blumeria gr... 110 2e-28 gb|PLB43598.1| 60S ribosomal protein L26 [Aspergillus steynii IB... 109 4e-28 >gb|KNG51441.1| 60s ribosomal protein l26 [Stemphylium lycopersici] Length = 105 Score = 139 bits (349), Expect = 3e-40 Identities = 69/72 (95%), Positives = 71/72 (98%) Frame = +2 Query: 2 KGREGKVTSVYRLKYALHVNGIVREKSNGQSVPIPIAPSKVVITKLKLDKDREQILERKS 181 KGREGKVTSVYRLKY +HVNGIVREKSNGQSVPIPIAPSKVV+TKLKLDKDREQILERKS Sbjct: 34 KGREGKVTSVYRLKYCIHVNGIVREKSNGQSVPIPIAPSKVVVTKLKLDKDREQILERKS 93 Query: 182 AGREEKKKQREA 217 AGREEKKKQREA Sbjct: 94 AGREEKKKQREA 105 >ref|XP_018387710.1| ribosomal protein L24 [Alternaria alternata] gb|OAG22289.1| ribosomal protein L24 [Alternaria alternata] gb|OWY48385.1| ribosomal protein L24 [Alternaria alternata] Length = 135 Score = 138 bits (348), Expect = 1e-39 Identities = 70/72 (97%), Positives = 71/72 (98%) Frame = +2 Query: 2 KGREGKVTSVYRLKYALHVNGIVREKSNGQSVPIPIAPSKVVITKLKLDKDREQILERKS 181 KGREGKV+SVYRLKY LHVNGIVREKSNGQSVPIPIAPSKVVITKLKLDKDREQILERKS Sbjct: 64 KGREGKVSSVYRLKYCLHVNGIVREKSNGQSVPIPIAPSKVVITKLKLDKDREQILERKS 123 Query: 182 AGREEKKKQREA 217 AGREEKKKQREA Sbjct: 124 AGREEKKKQREA 135 >ref|XP_007713820.1| hypothetical protein COCCADRAFT_100136 [Bipolaris zeicola 26-R-13] ref|XP_014559411.1| hypothetical protein COCVIDRAFT_35447 [Bipolaris victoriae FI3] gb|EUC31867.1| hypothetical protein COCCADRAFT_100136 [Bipolaris zeicola 26-R-13] gb|EUN29823.1| hypothetical protein COCVIDRAFT_35447 [Bipolaris victoriae FI3] Length = 135 Score = 135 bits (341), Expect = 1e-38 Identities = 68/72 (94%), Positives = 70/72 (97%) Frame = +2 Query: 2 KGREGKVTSVYRLKYALHVNGIVREKSNGQSVPIPIAPSKVVITKLKLDKDREQILERKS 181 KGREGKV+SVYRLKY +HVNGIVREKSNGQSVPIPIAPSKVVITKLKLDKDRE ILERKS Sbjct: 64 KGREGKVSSVYRLKYCIHVNGIVREKSNGQSVPIPIAPSKVVITKLKLDKDRESILERKS 123 Query: 182 AGREEKKKQREA 217 AGREEKKKQREA Sbjct: 124 AGREEKKKQREA 135 >ref|XP_001930861.1| 60S ribosomal protein L26 [Pyrenophora tritici-repentis Pt-1C-BFP] gb|EDU39966.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gb|EFQ88250.1| hypothetical protein PTT_15978 [Pyrenophora teres f. teres 0-1] Length = 135 Score = 135 bits (340), Expect = 2e-38 Identities = 67/72 (93%), Positives = 70/72 (97%) Frame = +2 Query: 2 KGREGKVTSVYRLKYALHVNGIVREKSNGQSVPIPIAPSKVVITKLKLDKDREQILERKS 181 KGREGKV+SVYRLKY +HVNGIVREKSNGQSVPIPIAPSKVV+TKLKLDKDRE ILERKS Sbjct: 64 KGREGKVSSVYRLKYCIHVNGIVREKSNGQSVPIPIAPSKVVVTKLKLDKDRESILERKS 123 Query: 182 AGREEKKKQREA 217 AGREEKKKQREA Sbjct: 124 AGREEKKKQREA 135 >ref|XP_014082578.1| hypothetical protein COCC4DRAFT_30433 [Bipolaris maydis ATCC 48331] gb|EMD91574.1| hypothetical protein COCHEDRAFT_1021505 [Bipolaris maydis C5] gb|ENI08669.1| hypothetical protein COCC4DRAFT_30433 [Bipolaris maydis ATCC 48331] Length = 135 Score = 135 bits (340), Expect = 2e-38 Identities = 68/72 (94%), Positives = 70/72 (97%) Frame = +2 Query: 2 KGREGKVTSVYRLKYALHVNGIVREKSNGQSVPIPIAPSKVVITKLKLDKDREQILERKS 181 KGREGKV+SVYRLKY +HVNGIVREKSNGQSVPIPIAPSKVVITKLKLDKDRE ILERKS Sbjct: 64 KGREGKVSSVYRLKYCIHVNGIVREKSNGQSVPIPIAPSKVVITKLKLDKDRETILERKS 123 Query: 182 AGREEKKKQREA 217 AGREEKKKQREA Sbjct: 124 AGREEKKKQREA 135 >ref|XP_007702866.1| hypothetical protein COCSADRAFT_344402 [Bipolaris sorokiniana ND90Pr] gb|EMD61552.1| hypothetical protein COCSADRAFT_344402 [Bipolaris sorokiniana ND90Pr] Length = 135 Score = 134 bits (336), Expect = 8e-38 Identities = 67/72 (93%), Positives = 69/72 (95%) Frame = +2 Query: 2 KGREGKVTSVYRLKYALHVNGIVREKSNGQSVPIPIAPSKVVITKLKLDKDREQILERKS 181 KGREGKV+SVYRLKY +HVNGIVREKSNGQSVP PIAPSKVVITKLKLDKDRE ILERKS Sbjct: 64 KGREGKVSSVYRLKYCIHVNGIVREKSNGQSVPTPIAPSKVVITKLKLDKDRESILERKS 123 Query: 182 AGREEKKKQREA 217 AGREEKKKQREA Sbjct: 124 AGREEKKKQREA 135 >gb|OAL50808.1| ribosomal protein L24 [Pyrenochaeta sp. DS3sAY3a] Length = 135 Score = 133 bits (335), Expect = 1e-37 Identities = 65/72 (90%), Positives = 70/72 (97%) Frame = +2 Query: 2 KGREGKVTSVYRLKYALHVNGIVREKSNGQSVPIPIAPSKVVITKLKLDKDREQILERKS 181 KGREGK+TSVYRLKY +HVNGIVREKSNGQSVPIPIAPSKVV+TKLKLDKDREQILERK+ Sbjct: 64 KGREGKITSVYRLKYVIHVNGIVREKSNGQSVPIPIAPSKVVVTKLKLDKDREQILERKN 123 Query: 182 AGREEKKKQREA 217 AGREEKKK+ EA Sbjct: 124 AGREEKKKRSEA 135 >ref|XP_007687056.1| hypothetical protein COCMIDRAFT_92753 [Bipolaris oryzae ATCC 44560] gb|EUC46434.1| hypothetical protein COCMIDRAFT_92753 [Bipolaris oryzae ATCC 44560] Length = 135 Score = 132 bits (333), Expect = 2e-37 Identities = 67/72 (93%), Positives = 69/72 (95%) Frame = +2 Query: 2 KGREGKVTSVYRLKYALHVNGIVREKSNGQSVPIPIAPSKVVITKLKLDKDREQILERKS 181 KGREGKV+SVYRLKY +HVNGIVREKSNGQSVPIPIA SKVVITKLKLDKDRE ILERKS Sbjct: 64 KGREGKVSSVYRLKYCIHVNGIVREKSNGQSVPIPIAASKVVITKLKLDKDRESILERKS 123 Query: 182 AGREEKKKQREA 217 AGREEKKKQREA Sbjct: 124 AGREEKKKQREA 135 >ref|XP_008030388.1| hypothetical protein SETTUDRAFT_97180 [Setosphaeria turcica Et28A] gb|EOA82059.1| hypothetical protein SETTUDRAFT_97180 [Setosphaeria turcica Et28A] Length = 135 Score = 132 bits (333), Expect = 2e-37 Identities = 67/72 (93%), Positives = 69/72 (95%) Frame = +2 Query: 2 KGREGKVTSVYRLKYALHVNGIVREKSNGQSVPIPIAPSKVVITKLKLDKDREQILERKS 181 KGREGKV+SVYRLKY +HVNGIVREKSNGQSVPIPIA SKVVITKLKLDKDRE ILERKS Sbjct: 64 KGREGKVSSVYRLKYCIHVNGIVREKSNGQSVPIPIAASKVVITKLKLDKDRESILERKS 123 Query: 182 AGREEKKKQREA 217 AGREEKKKQREA Sbjct: 124 AGREEKKKQREA 135 >ref|XP_001797270.1| hypothetical protein SNOG_06909 [Parastagonospora nodorum SN15] gb|EAT85560.1| hypothetical protein SNOG_06909 [Parastagonospora nodorum SN15] Length = 133 Score = 130 bits (326), Expect = 2e-36 Identities = 63/72 (87%), Positives = 70/72 (97%) Frame = +2 Query: 2 KGREGKVTSVYRLKYALHVNGIVREKSNGQSVPIPIAPSKVVITKLKLDKDREQILERKS 181 KGREGKVTSVYRLKY +HVNGIVREKSNGQSVPIP+APSKVV+TKLKLDKDRE+ILERKS Sbjct: 62 KGREGKVTSVYRLKYCIHVNGIVREKSNGQSVPIPLAPSKVVVTKLKLDKDREKILERKS 121 Query: 182 AGREEKKKQREA 217 GREEKKK+++A Sbjct: 122 NGREEKKKKQQA 133 >gb|OAK98745.1| ribosomal protein L24 [Stagonospora sp. SRC1lsM3a] Length = 135 Score = 127 bits (320), Expect = 2e-35 Identities = 61/72 (84%), Positives = 68/72 (94%) Frame = +2 Query: 2 KGREGKVTSVYRLKYALHVNGIVREKSNGQSVPIPIAPSKVVITKLKLDKDREQILERKS 181 KGREGK+TSVYRLKY +HVNGIVREKSNGQSVPIP+APSKVV+TKLKLDKDREQILERK Sbjct: 64 KGREGKITSVYRLKYCIHVNGIVREKSNGQSVPIPLAPSKVVVTKLKLDKDREQILERKK 123 Query: 182 AGREEKKKQREA 217 GREEKK +++A Sbjct: 124 NGREEKKSKQQA 135 >ref|XP_003836074.1| similar to 60S ribosomal protein L26 [Leptosphaeria maculans JN3] emb|CBX92709.1| similar to 60S ribosomal protein L26 [Leptosphaeria maculans JN3] Length = 136 Score = 126 bits (317), Expect = 6e-35 Identities = 64/71 (90%), Positives = 66/71 (92%) Frame = +2 Query: 2 KGREGKVTSVYRLKYALHVNGIVREKSNGQSVPIPIAPSKVVITKLKLDKDREQILERKS 181 KGREGK+ SVYRLKY LHV GIVREKSNGQSVPIPIAPSKVVITKLKLDKDREQILERKS Sbjct: 64 KGREGKIQSVYRLKYCLHVAGIVREKSNGQSVPIPIAPSKVVITKLKLDKDREQILERKS 123 Query: 182 AGREEKKKQRE 214 AGR EKKK+ E Sbjct: 124 AGRAEKKKRSE 134 >gb|KZM21807.1| structural constituent of ribosome [Ascochyta rabiei] Length = 132 Score = 125 bits (313), Expect = 2e-34 Identities = 62/72 (86%), Positives = 66/72 (91%) Frame = +2 Query: 2 KGREGKVTSVYRLKYALHVNGIVREKSNGQSVPIPIAPSKVVITKLKLDKDREQILERKS 181 KGREGKV SVYRLKY +HVNGIVREKSNGQSVP+PIAPSKVVITKLKLDKDREQILERKS Sbjct: 61 KGREGKVNSVYRLKYCIHVNGIVREKSNGQSVPVPIAPSKVVITKLKLDKDREQILERKS 120 Query: 182 AGREEKKKQREA 217 AGR KK++ A Sbjct: 121 AGRAAKKEKSSA 132 >ref|XP_018043097.1| ribosomal protein L24 [Paraphaeosphaeria sporulosa] gb|OAG12732.1| ribosomal protein L24 [Paraphaeosphaeria sporulosa] Length = 135 Score = 122 bits (307), Expect = 2e-33 Identities = 61/72 (84%), Positives = 66/72 (91%) Frame = +2 Query: 2 KGREGKVTSVYRLKYALHVNGIVREKSNGQSVPIPIAPSKVVITKLKLDKDREQILERKS 181 KGREGKVTSVYRLKYALH+NG+VREKSNGQSVPIPIA SKVV+TKLKLDKDRE ILER S Sbjct: 64 KGREGKVTSVYRLKYALHINGVVREKSNGQSVPIPIAASKVVVTKLKLDKDRENILERIS 123 Query: 182 AGREEKKKQREA 217 GRE +KK+ EA Sbjct: 124 QGREAQKKKSEA 135 >gb|OSS45766.1| hypothetical protein B5807_09594 [Epicoccum nigrum] Length = 134 Score = 121 bits (304), Expect = 5e-33 Identities = 59/71 (83%), Positives = 65/71 (91%) Frame = +2 Query: 2 KGREGKVTSVYRLKYALHVNGIVREKSNGQSVPIPIAPSKVVITKLKLDKDREQILERKS 181 KGREGK+ SVYRLKY +HVNGIVREKSNGQSVP+PIA SKVVITKLKLDKDREQILERK Sbjct: 61 KGREGKINSVYRLKYCIHVNGIVREKSNGQSVPVPIATSKVVITKLKLDKDREQILERKG 120 Query: 182 AGREEKKKQRE 214 AGR KK+++E Sbjct: 121 AGRAAKKEKKE 131 >gb|ORY06635.1| translation protein SH3-like domain-containing protein [Clohesyomyces aquaticus] Length = 134 Score = 113 bits (282), Expect = 1e-29 Identities = 55/70 (78%), Positives = 61/70 (87%) Frame = +2 Query: 2 KGREGKVTSVYRLKYALHVNGIVREKSNGQSVPIPIAPSKVVITKLKLDKDREQILERKS 181 KGREGKV+SVYRLKY +HVNG+VREKSNGQSVPIPIA SKVV+TKLKLDKDRE ILER Sbjct: 64 KGREGKVSSVYRLKYVIHVNGVVREKSNGQSVPIPIAASKVVVTKLKLDKDRENILERIG 123 Query: 182 AGREEKKKQR 211 GR+ KK + Sbjct: 124 QGRDAAKKSK 133 >emb|CCU74360.1| 60S ribosomal protein L26 [Blumeria graminis f. sp. hordei DH14] Length = 139 Score = 110 bits (276), Expect = 1e-28 Identities = 54/72 (75%), Positives = 62/72 (86%) Frame = +2 Query: 2 KGREGKVTSVYRLKYALHVNGIVREKSNGQSVPIPIAPSKVVITKLKLDKDREQILERKS 181 KGREGK+TSVYRLKY +HV +V+EKS+ QSVP+ I PSKVVITKLK+DKDREQILER Sbjct: 64 KGREGKITSVYRLKYVVHVERVVKEKSSSQSVPLGIHPSKVVITKLKIDKDREQILERIK 123 Query: 182 AGREEKKKQREA 217 GRE KKKQ+EA Sbjct: 124 VGRENKKKQKEA 135 >emb|CEL04641.1| Putative Ribosomal protein L26 (AFU_orthologue; AFUA_6G11260) [Aspergillus calidoustus] Length = 134 Score = 110 bits (275), Expect = 1e-28 Identities = 56/69 (81%), Positives = 60/69 (86%) Frame = +2 Query: 2 KGREGKVTSVYRLKYALHVNGIVREKSNGQSVPIPIAPSKVVITKLKLDKDREQILERKS 181 KGREGKVTSVYRLK+A+HV IVREKSNGQSVPIP+APS VVITKLKLDKDREQILER Sbjct: 64 KGREGKVTSVYRLKWAIHVERIVREKSNGQSVPIPLAPSNVVITKLKLDKDREQILERIG 123 Query: 182 AGREEKKKQ 208 GRE K + Sbjct: 124 KGREAVKSK 132 >gb|EPQ62114.1| hypothetical protein BGT96224_A20452 [Blumeria graminis f. sp. tritici 96224] Length = 139 Score = 110 bits (275), Expect = 2e-28 Identities = 53/72 (73%), Positives = 62/72 (86%) Frame = +2 Query: 2 KGREGKVTSVYRLKYALHVNGIVREKSNGQSVPIPIAPSKVVITKLKLDKDREQILERKS 181 KGREGK+TSVYRLKY +H+ +V+EKS+ QSVP+ I PSKVVITKLK+DKDREQILER Sbjct: 64 KGREGKITSVYRLKYVVHIERVVKEKSSSQSVPLGIHPSKVVITKLKIDKDREQILERIK 123 Query: 182 AGREEKKKQREA 217 GRE KKKQ+EA Sbjct: 124 VGRENKKKQKEA 135 >gb|PLB43598.1| 60S ribosomal protein L26 [Aspergillus steynii IBT 23096] Length = 134 Score = 109 bits (272), Expect = 4e-28 Identities = 54/69 (78%), Positives = 60/69 (86%) Frame = +2 Query: 2 KGREGKVTSVYRLKYALHVNGIVREKSNGQSVPIPIAPSKVVITKLKLDKDREQILERKS 181 KGREGKVTSVYRLK+A+HV +VREKSNGQSVP+P+APS VVITKLKLDKDREQILER Sbjct: 64 KGREGKVTSVYRLKWAIHVERVVREKSNGQSVPLPLAPSNVVITKLKLDKDREQILERIG 123 Query: 182 AGREEKKKQ 208 GRE K + Sbjct: 124 KGREAVKSK 132