BLASTX nr result
ID: Chrysanthemum21_contig00027832
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00027832 (369 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY69050.1| hypothetical protein LSAT_9X89160 [Lactuca sativa] 54 8e-06 >gb|PLY69050.1| hypothetical protein LSAT_9X89160 [Lactuca sativa] Length = 525 Score = 53.9 bits (128), Expect = 8e-06 Identities = 31/52 (59%), Positives = 40/52 (76%), Gaps = 5/52 (9%) Frame = -3 Query: 142 QMGSKRLDYLIEASSGLHFSLCNMNGRIQARDSRL-----TSSVPENMQKQP 2 +MGSK ++YLIEASSG HFS +MNG +QAR+S+L T+SV EN+ KQP Sbjct: 52 KMGSKPVEYLIEASSGAHFSGFHMNG-MQARNSQLQEGQATTSVTENVHKQP 102