BLASTX nr result
ID: Chrysanthemum21_contig00027747
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00027747 (419 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAQ63935.1| cellulose synthase [Pinus radiata] 58 5e-07 gb|OWM87882.1| hypothetical protein CDL15_Pgr008328 [Punica gran... 56 3e-06 ref|XP_019242161.1| PREDICTED: cellulose synthase A catalytic su... 53 5e-06 gb|OIT18821.1| cellulose synthase a catalytic subunit 1 [udp-for... 53 5e-06 gb|PIA65586.1| hypothetical protein AQUCO_00100824v1 [Aquilegia ... 55 5e-06 ref|XP_021740976.1| cellulose synthase A catalytic subunit 3 [UD... 55 6e-06 ref|XP_021724117.1| cellulose synthase A catalytic subunit 3 [UD... 55 6e-06 ref|XP_010667061.1| PREDICTED: cellulose synthase A catalytic su... 55 6e-06 gb|AEP33539.1| cellulose synthase catalytic subunit [Gossypium t... 55 6e-06 gb|PIA65585.1| hypothetical protein AQUCO_00100824v1 [Aquilegia ... 55 6e-06 ref|XP_011071168.1| cellulose synthase A catalytic subunit 1 [UD... 55 6e-06 ref|XP_012843418.1| PREDICTED: cellulose synthase A catalytic su... 55 6e-06 gb|KZN05392.1| hypothetical protein DCAR_006229 [Daucus carota s... 52 6e-06 ref|XP_020270207.1| probable cellulose synthase A catalytic subu... 55 7e-06 gb|PPD91559.1| hypothetical protein GOBAR_DD11497 [Gossypium bar... 55 8e-06 gb|KHG16921.1| Cellulose synthase A catalytic subunit 3 [UDP-for... 55 8e-06 ref|XP_022859311.1| cellulose synthase A catalytic subunit 1 [UD... 55 8e-06 gb|AEP33547.1| cellulose synthase catalytic subunit [Gossypium b... 55 8e-06 gb|AEP33559.1| cellulose synthase catalytic subunit [Gossypium t... 55 8e-06 gb|AEP33557.1| cellulose synthase catalytic subunit [Gossypium g... 55 8e-06 >gb|AAQ63935.1| cellulose synthase [Pinus radiata] Length = 1096 Score = 58.2 bits (139), Expect = 5e-07 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +3 Query: 240 PVCRWCYEYHWRDGNHSCPRCKTRYKIQK 326 PVCR CYEY W+DGN SCP+CKTRYK K Sbjct: 64 PVCRPCYEYEWKDGNQSCPQCKTRYKWHK 92 >gb|OWM87882.1| hypothetical protein CDL15_Pgr008328 [Punica granatum] Length = 1068 Score = 55.8 bits (133), Expect = 3e-06 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = +3 Query: 240 PVCRWCYEYHWRDGNHSCPRCKTRYKIQKVLMV 338 PVCR CYEY +DGN SCP+CK RYK QKV M+ Sbjct: 64 PVCRPCYEYERKDGNQSCPQCKIRYKRQKVCML 96 >ref|XP_019242161.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like, partial [Nicotiana attenuata] Length = 128 Score = 52.8 bits (125), Expect = 5e-06 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +3 Query: 240 PVCRWCYEYHWRDGNHSCPRCKTRYKIQK 326 PVCR CYEY +DGN SCP+CKTRYK K Sbjct: 64 PVCRSCYEYERKDGNQSCPQCKTRYKRYK 92 >gb|OIT18821.1| cellulose synthase a catalytic subunit 1 [udp-forming] [Nicotiana attenuata] Length = 129 Score = 52.8 bits (125), Expect = 5e-06 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +3 Query: 240 PVCRWCYEYHWRDGNHSCPRCKTRYKIQK 326 PVCR CYEY +DGN SCP+CKTRYK K Sbjct: 64 PVCRSCYEYERKDGNQSCPQCKTRYKRYK 92 >gb|PIA65586.1| hypothetical protein AQUCO_00100824v1 [Aquilegia coerulea] Length = 817 Score = 55.1 bits (131), Expect = 5e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +3 Query: 240 PVCRWCYEYHWRDGNHSCPRCKTRYKIQK 326 PVCR CYEY +DGN SCP+CKTRYK QK Sbjct: 64 PVCRACYEYERKDGNQSCPQCKTRYKRQK 92 >ref|XP_021740976.1| cellulose synthase A catalytic subunit 3 [UDP-forming]-like [Chenopodium quinoa] Length = 1058 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +3 Query: 240 PVCRWCYEYHWRDGNHSCPRCKTRYKIQK 326 PVCR CYEY +DGN SCP+CKTRYK QK Sbjct: 43 PVCRACYEYERKDGNQSCPQCKTRYKRQK 71 >ref|XP_021724117.1| cellulose synthase A catalytic subunit 3 [UDP-forming]-like [Chenopodium quinoa] Length = 1060 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +3 Query: 240 PVCRWCYEYHWRDGNHSCPRCKTRYKIQK 326 PVCR CYEY +DGN SCP+CKTRYK QK Sbjct: 43 PVCRACYEYERKDGNQSCPQCKTRYKRQK 71 >ref|XP_010667061.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] [Beta vulgaris subsp. vulgaris] gb|KMS95638.1| hypothetical protein BVRB_006490 [Beta vulgaris subsp. vulgaris] Length = 1061 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +3 Query: 240 PVCRWCYEYHWRDGNHSCPRCKTRYKIQK 326 PVCR CYEY +DGN SCP+CKTRYK QK Sbjct: 45 PVCRACYEYERKDGNQSCPQCKTRYKKQK 73 >gb|AEP33539.1| cellulose synthase catalytic subunit [Gossypium turneri] Length = 1067 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +3 Query: 240 PVCRWCYEYHWRDGNHSCPRCKTRYKIQK 326 PVCR CYEY +DGN SCP+CKTRYK QK Sbjct: 45 PVCRRCYEYERKDGNQSCPQCKTRYKWQK 73 >gb|PIA65585.1| hypothetical protein AQUCO_00100824v1 [Aquilegia coerulea] Length = 1082 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +3 Query: 240 PVCRWCYEYHWRDGNHSCPRCKTRYKIQK 326 PVCR CYEY +DGN SCP+CKTRYK QK Sbjct: 64 PVCRACYEYERKDGNQSCPQCKTRYKRQK 92 >ref|XP_011071168.1| cellulose synthase A catalytic subunit 1 [UDP-forming] [Sesamum indicum] Length = 1084 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +3 Query: 240 PVCRWCYEYHWRDGNHSCPRCKTRYKIQK 326 PVCR CYEY +DGN SCP+CKTRYK QK Sbjct: 64 PVCRACYEYERKDGNQSCPQCKTRYKRQK 92 >ref|XP_012843418.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] [Erythranthe guttata] gb|EYU32338.1| hypothetical protein MIMGU_mgv1a000544mg [Erythranthe guttata] Length = 1084 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +3 Query: 240 PVCRWCYEYHWRDGNHSCPRCKTRYKIQK 326 PVCR CYEY +DGN SCP+CKTRYK QK Sbjct: 64 PVCRACYEYERKDGNQSCPQCKTRYKRQK 92 >gb|KZN05392.1| hypothetical protein DCAR_006229 [Daucus carota subsp. sativus] Length = 90 Score = 51.6 bits (122), Expect = 6e-06 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = +3 Query: 240 PVCRWCYEYHWRDGNHSCPRCKTRYK 317 PVCR CYEY R+GN SCP+CKTRYK Sbjct: 40 PVCRPCYEYERREGNQSCPQCKTRYK 65 >ref|XP_020270207.1| probable cellulose synthase A catalytic subunit 1 [UDP-forming] [Asparagus officinalis] gb|ONK66597.1| uncharacterized protein A4U43_C06F10010 [Asparagus officinalis] Length = 899 Score = 54.7 bits (130), Expect = 7e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +3 Query: 240 PVCRWCYEYHWRDGNHSCPRCKTRYKIQK 326 PVCR CYEY +DGN SCP+CKTRYK QK Sbjct: 64 PVCRPCYEYERKDGNRSCPQCKTRYKRQK 92 >gb|PPD91559.1| hypothetical protein GOBAR_DD11497 [Gossypium barbadense] Length = 1047 Score = 54.7 bits (130), Expect = 8e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +3 Query: 240 PVCRWCYEYHWRDGNHSCPRCKTRYKIQK 326 PVCR CYEY +DGN SCP+CKTRYK QK Sbjct: 45 PVCRPCYEYERKDGNQSCPQCKTRYKWQK 73 >gb|KHG16921.1| Cellulose synthase A catalytic subunit 3 [UDP-forming] [Gossypium arboreum] Length = 1064 Score = 54.7 bits (130), Expect = 8e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +3 Query: 240 PVCRWCYEYHWRDGNHSCPRCKTRYKIQK 326 PVCR CYEY +DGN SCP+CKTRYK QK Sbjct: 45 PVCRPCYEYERKDGNQSCPQCKTRYKWQK 73 >ref|XP_022859311.1| cellulose synthase A catalytic subunit 1 [UDP-forming]-like, partial [Olea europaea var. sylvestris] Length = 1065 Score = 54.7 bits (130), Expect = 8e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +3 Query: 240 PVCRWCYEYHWRDGNHSCPRCKTRYKIQK 326 PVCR CYEY +DGN SCP+CKTRYK QK Sbjct: 45 PVCRPCYEYERKDGNQSCPQCKTRYKRQK 73 >gb|AEP33547.1| cellulose synthase catalytic subunit [Gossypium barbadense var. brasiliense] gb|AEP33549.1| cellulose synthase catalytic subunit [Gossypium barbadense var. peruvianum] Length = 1066 Score = 54.7 bits (130), Expect = 8e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +3 Query: 240 PVCRWCYEYHWRDGNHSCPRCKTRYKIQK 326 PVCR CYEY +DGN SCP+CKTRYK QK Sbjct: 45 PVCRPCYEYERKDGNQSCPQCKTRYKWQK 73 >gb|AEP33559.1| cellulose synthase catalytic subunit [Gossypium trilobum] Length = 1067 Score = 54.7 bits (130), Expect = 8e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +3 Query: 240 PVCRWCYEYHWRDGNHSCPRCKTRYKIQK 326 PVCR CYEY +DGN SCP+CKTRYK QK Sbjct: 45 PVCRPCYEYERKDGNQSCPQCKTRYKWQK 73 >gb|AEP33557.1| cellulose synthase catalytic subunit [Gossypium gossypioides] Length = 1067 Score = 54.7 bits (130), Expect = 8e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +3 Query: 240 PVCRWCYEYHWRDGNHSCPRCKTRYKIQK 326 PVCR CYEY +DGN SCP+CKTRYK QK Sbjct: 45 PVCRPCYEYERKDGNQSCPQCKTRYKWQK 73