BLASTX nr result
ID: Chrysanthemum21_contig00027738
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00027738 (363 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OAY82885.1| Receptor region, transmembrane domain- and RING d... 54 5e-06 ref|XP_020096571.1| receptor homology region, transmembrane doma... 54 5e-06 ref|XP_020096562.1| receptor homology region, transmembrane doma... 54 5e-06 >gb|OAY82885.1| Receptor region, transmembrane domain- and RING domain-containing protein 1 [Ananas comosus] Length = 372 Score = 54.3 bits (129), Expect = 5e-06 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +2 Query: 227 KMFKCCWFSVMCLMMMMGGYGVVANVVLMGNNLTLSFEDIEANFA 361 K + C F ++ ++ MM G G ANVVLMGNN+TLSF+D+EANFA Sbjct: 10 KRYLLCSFVIVAVIYMMAGLGA-ANVVLMGNNVTLSFDDVEANFA 53 >ref|XP_020096571.1| receptor homology region, transmembrane domain- and RING domain-containing protein 1-like isoform X2 [Ananas comosus] Length = 454 Score = 54.3 bits (129), Expect = 5e-06 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +2 Query: 227 KMFKCCWFSVMCLMMMMGGYGVVANVVLMGNNLTLSFEDIEANFA 361 K + C F ++ ++ MM G G ANVVLMGNN+TLSF+D+EANFA Sbjct: 10 KRYLLCSFVIVAVIYMMAGLGA-ANVVLMGNNVTLSFDDVEANFA 53 >ref|XP_020096562.1| receptor homology region, transmembrane domain- and RING domain-containing protein 1-like isoform X1 [Ananas comosus] Length = 456 Score = 54.3 bits (129), Expect = 5e-06 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +2 Query: 227 KMFKCCWFSVMCLMMMMGGYGVVANVVLMGNNLTLSFEDIEANFA 361 K + C F ++ ++ MM G G ANVVLMGNN+TLSF+D+EANFA Sbjct: 10 KRYLLCSFVIVAVIYMMAGLGA-ANVVLMGNNVTLSFDDVEANFA 53