BLASTX nr result
ID: Chrysanthemum21_contig00027517
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00027517 (474 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023748354.1| eukaryotic translation initiation factor 6-2... 62 1e-08 ref|XP_022013711.1| eukaryotic translation initiation factor 6-2... 62 2e-08 gb|KVI02993.1| Translation initiation factor IF6 [Cynara cardunc... 60 1e-07 gb|PPD80808.1| hypothetical protein GOBAR_DD22256 [Gossypium bar... 58 5e-07 gb|KJB73467.1| hypothetical protein B456_011G234100, partial [Go... 57 2e-06 gb|KJB73466.1| hypothetical protein B456_011G234100, partial [Go... 57 2e-06 gb|PNX85708.1| eukaryotic translation initiation factor 6-2-like... 53 3e-06 gb|OMO84878.1| Translation initiation factor IF6 [Corchorus olit... 56 3e-06 ref|XP_014216492.1| eukaryotic translation initiation factor 6 [... 56 3e-06 gb|PNX55707.1| eukaryotic translation initiation factor 6-2-like... 51 4e-06 gb|KOX74230.1| Eukaryotic translation initiation factor 6 [Melip... 55 5e-06 ref|XP_001744172.1| hypothetical protein [Monosiga brevicollis M... 55 5e-06 ref|XP_001730047.1| hypothetical protein MGL_3033 [Malassezia gl... 55 5e-06 ref|XP_021911239.1| eukaryotic translation initiation factor 6-2... 52 5e-06 ref|XP_015895402.1| PREDICTED: eukaryotic translation initiation... 55 7e-06 gb|OAD59052.1| Eukaryotic translation initiation factor 6 [Eufri... 54 8e-06 ref|XP_001431133.1| hypothetical protein [Paramecium tetraurelia... 54 9e-06 ref|XP_022208011.1| eukaryotic translation initiation factor 6-l... 54 1e-05 ref|XP_015120919.1| PREDICTED: eukaryotic translation initiation... 54 1e-05 ref|XP_001432529.1| hypothetical protein [Paramecium tetraurelia... 54 1e-05 >ref|XP_023748354.1| eukaryotic translation initiation factor 6-2-like [Lactuca sativa] gb|PLY96206.1| hypothetical protein LSAT_3X68941 [Lactuca sativa] Length = 245 Score = 62.4 bits (150), Expect = 1e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 399 KLRFENSSEIGVFTKLTNSYCLVANEGSEGFYRL 298 +LRFENS EIGVFTKLTN+YCLVANEGSE FY + Sbjct: 4 RLRFENSCEIGVFTKLTNAYCLVANEGSESFYSI 37 >ref|XP_022013711.1| eukaryotic translation initiation factor 6-2-like [Helianthus annuus] gb|OTG33647.1| putative translation initiation factor IF6 [Helianthus annuus] Length = 268 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 399 KLRFENSSEIGVFTKLTNSYCLVANEGSEGFY 304 +LRFENS EIGVFTKLTNSYCLVANEGS+ FY Sbjct: 4 RLRFENSCEIGVFTKLTNSYCLVANEGSDSFY 35 >gb|KVI02993.1| Translation initiation factor IF6 [Cynara cardunculus var. scolymus] Length = 273 Score = 60.1 bits (144), Expect = 1e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 399 KLRFENSSEIGVFTKLTNSYCLVANEGSEGFYRL 298 +LRFENS EIGVFTKLTN YCLVA+EGSE FY + Sbjct: 4 RLRFENSCEIGVFTKLTNGYCLVADEGSESFYSI 37 >gb|PPD80808.1| hypothetical protein GOBAR_DD22256 [Gossypium barbadense] Length = 290 Score = 58.2 bits (139), Expect = 5e-07 Identities = 28/50 (56%), Positives = 36/50 (72%) Frame = -1 Query: 453 FSIILFGRMNRLWCMYCYKLRFENSSEIGVFTKLTNSYCLVANEGSEGFY 304 F +L +NRL + +L+FENS E+GVF+KLTN+YCLVA GSE FY Sbjct: 31 FLSVLIFLINRLCLIMATRLQFENSCEVGVFSKLTNAYCLVAIGGSENFY 80 >gb|KJB73467.1| hypothetical protein B456_011G234100, partial [Gossypium raimondii] Length = 327 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -1 Query: 429 MNRLWCMYCYKLRFENSSEIGVFTKLTNSYCLVANEGSEGFY 304 +NRL + +L+FENS E+GVF+KLTN+YCLVA GSE FY Sbjct: 76 INRLCLIMATRLQFENSCEVGVFSKLTNAYCLVAIGGSENFY 117 >gb|KJB73466.1| hypothetical protein B456_011G234100, partial [Gossypium raimondii] Length = 337 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -1 Query: 429 MNRLWCMYCYKLRFENSSEIGVFTKLTNSYCLVANEGSEGFY 304 +NRL + +L+FENS E+GVF+KLTN+YCLVA GSE FY Sbjct: 86 INRLCLIMATRLQFENSCEVGVFSKLTNAYCLVAIGGSENFY 127 >gb|PNX85708.1| eukaryotic translation initiation factor 6-2-like protein [Trifolium pratense] Length = 76 Score = 52.8 bits (125), Expect = 3e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 399 KLRFENSSEIGVFTKLTNSYCLVANEGSEGFY 304 +L+FENS E+GVF+KLTN+YCLVA GSE FY Sbjct: 4 RLKFENSCEVGVFSKLTNAYCLVAIGGSENFY 35 >gb|OMO84878.1| Translation initiation factor IF6 [Corchorus olitorius] Length = 245 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 399 KLRFENSSEIGVFTKLTNSYCLVANEGSEGFY 304 +L+FENS E+GVF+KLTN+YCLVAN GSE FY Sbjct: 4 RLQFENSCEVGVFSKLTNAYCLVANGGSENFY 35 >ref|XP_014216492.1| eukaryotic translation initiation factor 6 [Copidosoma floridanum] Length = 245 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/51 (50%), Positives = 38/51 (74%) Frame = -1 Query: 399 KLRFENSSEIGVFTKLTNSYCLVANEGSEGFYRLHKIHATRVM*YIYCTFS 247 +L+FEN++EIGVF+KLTNSYCLVA GSE FY +++ V+ I+ + + Sbjct: 4 RLQFENNNEIGVFSKLTNSYCLVAIGGSENFYSVYEAELADVIPVIHTSLA 54 >gb|PNX55707.1| eukaryotic translation initiation factor 6-2-like protein, partial [Trifolium pratense] Length = 40 Score = 51.2 bits (121), Expect = 4e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -1 Query: 396 LRFENSSEIGVFTKLTNSYCLVANEGSEGFYR 301 L+FENS EIG F+KLTN+YCLVA GSE FYR Sbjct: 2 LQFENSCEIGDFSKLTNAYCLVAIGGSENFYR 33 >gb|KOX74230.1| Eukaryotic translation initiation factor 6 [Melipona quadrifasciata] Length = 245 Score = 55.1 bits (131), Expect = 5e-06 Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = -1 Query: 399 KLRFENSSEIGVFTKLTNSYCLVANEGSEGFYR-LHKIHAT 280 +++FEN++E+GVF+KLTNSYCLVA GSE FYR + IHA+ Sbjct: 4 RVQFENNNEVGVFSKLTNSYCLVAIGGSENFYRTIPVIHAS 44 >ref|XP_001744172.1| hypothetical protein [Monosiga brevicollis MX1] gb|EDQ90875.1| predicted protein [Monosiga brevicollis MX1] Length = 245 Score = 55.1 bits (131), Expect = 5e-06 Identities = 26/49 (53%), Positives = 33/49 (67%) Frame = -1 Query: 399 KLRFENSSEIGVFTKLTNSYCLVANEGSEGFYRLHKIHATRVM*YIYCT 253 + +FE S+EIGVF KLTNSYCL A GSE FY + + V+ I+CT Sbjct: 4 RAQFEGSNEIGVFAKLTNSYCLTALGGSENFYSIFESEVGEVVPVIHCT 52 >ref|XP_001730047.1| hypothetical protein MGL_3033 [Malassezia globosa CBS 7966] gb|EDP42833.1| hypothetical protein MGL_3033 [Malassezia globosa CBS 7966] Length = 245 Score = 55.1 bits (131), Expect = 5e-06 Identities = 26/51 (50%), Positives = 34/51 (66%) Frame = -1 Query: 399 KLRFENSSEIGVFTKLTNSYCLVANEGSEGFYRLHKIHATRVM*YIYCTFS 247 + +FENSSEIGVF +LTN YCLVA GS FY +I +M ++CT + Sbjct: 4 RCQFENSSEIGVFARLTNWYCLVAVGGSANFYTTFEIELADLMPVVHCTIA 54 >ref|XP_021911239.1| eukaryotic translation initiation factor 6-2-like [Carica papaya] Length = 92 Score = 52.4 bits (124), Expect = 5e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 399 KLRFENSSEIGVFTKLTNSYCLVANEGSEGFY 304 +L+FENS E+GVF+KLTN+YCLVA GSE FY Sbjct: 4 RLQFENSCEVGVFSKLTNAYCLVAIGGSENFY 35 >ref|XP_015895402.1| PREDICTED: eukaryotic translation initiation factor 6-2 isoform X1 [Ziziphus jujuba] ref|XP_015895403.1| PREDICTED: eukaryotic translation initiation factor 6-2 isoform X2 [Ziziphus jujuba] Length = 245 Score = 54.7 bits (130), Expect = 7e-06 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = -1 Query: 399 KLRFENSSEIGVFTKLTNSYCLVANEGSEGFYRLHKIHATRVM 271 +++FENS EIGVF+KLTN+YCLVA GSE FY H+ V+ Sbjct: 4 RVQFENSCEIGVFSKLTNAYCLVAIGGSENFYSAHEAELADVI 46 >gb|OAD59052.1| Eukaryotic translation initiation factor 6 [Eufriesea mexicana] Length = 186 Score = 53.9 bits (128), Expect = 8e-06 Identities = 24/49 (48%), Positives = 36/49 (73%) Frame = -1 Query: 399 KLRFENSSEIGVFTKLTNSYCLVANEGSEGFYRLHKIHATRVM*YIYCT 253 +++FEN++EIGVF+KLTNSYCLVA GSE FY + + ++ I+ + Sbjct: 4 RVQFENNNEIGVFSKLTNSYCLVAIGGSENFYSVFEAELAEIIPVIHAS 52 >ref|XP_001431133.1| hypothetical protein [Paramecium tetraurelia strain d4-2] emb|CAK63735.1| unnamed protein product [Paramecium tetraurelia] Length = 240 Score = 54.3 bits (129), Expect = 9e-06 Identities = 26/49 (53%), Positives = 35/49 (71%) Frame = -1 Query: 399 KLRFENSSEIGVFTKLTNSYCLVANEGSEGFYRLHKIHATRVM*YIYCT 253 + +FENS++IGVF+KLTNSYCLVA GSE FY + + M I+C+ Sbjct: 4 RCQFENSNDIGVFSKLTNSYCLVALGGSENFYSVFESELGLSMPVIHCS 52 >ref|XP_022208011.1| eukaryotic translation initiation factor 6-like [Nilaparvata lugens] Length = 245 Score = 54.3 bits (129), Expect = 1e-05 Identities = 23/51 (45%), Positives = 37/51 (72%) Frame = -1 Query: 399 KLRFENSSEIGVFTKLTNSYCLVANEGSEGFYRLHKIHATRVM*YIYCTFS 247 +++FEN++EIGVF+KLTN+YCLV GSE FY + + V+ ++C+ + Sbjct: 4 RVQFENNNEIGVFSKLTNAYCLVGIGGSENFYSVFEAELNDVIPVVHCSLA 54 >ref|XP_015120919.1| PREDICTED: eukaryotic translation initiation factor 6 [Diachasma alloeum] Length = 245 Score = 54.3 bits (129), Expect = 1e-05 Identities = 24/51 (47%), Positives = 37/51 (72%) Frame = -1 Query: 399 KLRFENSSEIGVFTKLTNSYCLVANEGSEGFYRLHKIHATRVM*YIYCTFS 247 +++FENS+E+GVF+KLTNSYCLVA GSE FY + + + + I+ + + Sbjct: 4 RVQFENSNEVGVFSKLTNSYCLVAIGGSENFYSVFEAELSETVPVIHASIA 54 >ref|XP_001432529.1| hypothetical protein [Paramecium tetraurelia strain d4-2] emb|CAK65132.1| unnamed protein product [Paramecium tetraurelia] Length = 245 Score = 54.3 bits (129), Expect = 1e-05 Identities = 26/49 (53%), Positives = 35/49 (71%) Frame = -1 Query: 399 KLRFENSSEIGVFTKLTNSYCLVANEGSEGFYRLHKIHATRVM*YIYCT 253 + +FENS++IGVF+KLTNSYCLVA GSE FY + + M I+C+ Sbjct: 4 RCQFENSNDIGVFSKLTNSYCLVALGGSENFYSVFESELGLSMPVIHCS 52